Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)

Boster Bio Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5) catalog # M01571-1. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: M01571-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)

See all AIF products

SKU/Catalog Number

M01571-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5) catalog # M01571-1. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M01571-1)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Monoclonal

Clone Number

2I5

Isotype

IgG1

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human AIF (582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M01571-1 is reactive to AIFM1 in Human, Mouse, Rat

Applications

M01571-1 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunofluorescence, 2μg/ml
Immunocytochemistry/Immunofluorescence, 5μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For AIFM1 (Source: Uniprot.Org, NCBI)

Uniprot ID

O95831

Gene ID

9131

Gene Name

AIFM1

Full Name

Apoptosis-inducing factor 1, mitochondrial

Weight

66.901kDa

Superfamily

FAD-dependent oxidoreductase family

Alternative Names

AIF; AIFapoptosis-inducing factor 1, mitochondrial; AIFM1; apoptosis-inducing factor, mitochondrion-associated, 1; COXPD6; MGC111425; PDCD8; PDCD8striatal apoptosis-inducing factor; programmed cell death 8 (apoptosis-inducing factor); Programmed cell death protein 8 AIFM1 AIF, AUNX1, CMT2D, CMTX4, COWCK, COXPD6, DFNX5, NADMR, NAMSD, PDCD8, SEMDHL apoptosis inducing factor mitochondria associated 1 apoptosis-inducing factor 1, mitochondrial|apoptosis-inducing factor, mitochondrion-associated, 1|auditory neuropathy, X-linked recessive 1|programmed cell death 8 (apoptosis-inducing factor)|striatal apoptosis-inducing factor|testicular secretory protein Li 4

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on AIFM1, check out the AIFM1 Infographic

AIFM1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for AIFM1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

M01571-1 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Wnt5a Increases Properties of Lung Cancer Stem Cells and Resistance to Cisplatin through Activation of Wnt5a/PKC Signaling Pathway

Mechanism of apoptosis induction in human hepatocellular carcinoma cells following treatment with a gecko peptides mixture

Toll-like receptor 4 contributes to chronic itch, alloknesis, and spinal astrocyte activation in male mice

Have you used Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)

Question

We bought anti-AIF antibody (monoclonal, 2I5) for Flow Cytometry on lymphocyte last year. I am using rat, and We intend to use the antibody for IF next. My lab would like examining lymphocyte as well as glial tumor in our next experiment. Could give a recommendation on which antibody would work the best for IF?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

I have checked the website and datasheets of our anti-AIF antibody (monoclonal, 2I5) and it seems that M01571-1 has been validated on rat in both Flow Cytometry and IF. Thus M01571-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IF in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IF detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-03-24

Question

We are currently using anti-AIF antibody (monoclonal, 2I5) M01571-1 for mouse tissue, and we are well pleased with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on canine tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-15

Answer

The anti-AIF antibody (monoclonal, 2I5) (M01571-1) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-15

Question

My boss were satisfied with the WB result of your anti-AIF antibody (monoclonal, 2I5). However we have observed positive staining in erythroleukemia cytoskeleton using this antibody. Is that expected? Could you tell me where is AIF1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-10-03

Answer

From literature, erythroleukemia does express AIF1. Generally AIF1 expresses in cytoplasm, cytoskeleton. Regarding which tissues have AIF1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Glial tumor, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Lymphocyte, Pubmed ID: 8912632
Prostate, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2017-10-03

Question

We have seen staining in mouse liver. Do you have any suggestions? Is anti-AIF antibody (monoclonal, 2I5) supposed to stain liver positively?

A. Zhang

Verified customer

Asked: 2017-06-29

Answer

From literature liver does express AIF1. From Uniprot.org, AIF1 is expressed in metanephric glomerulus, lymphocyte, glial tumor, prostate, erythroleukemia, liver, among other tissues. Regarding which tissues have AIF1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Glial tumor, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Lymphocyte, Pubmed ID: 8912632
Prostate, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2017-06-29

$280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
M01571-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.