Anti-AKR1B10 Antibody Picoband™

Boster Bio Anti-AKR1B10 Antibody Picoband™ catalog # A02976. Tested in IHC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A02976
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC, WB

Product Name

Anti-AKR1B10 Antibody Picoband™

See all Aldo-keto Reductase 1B10/AKR1B10 products

SKU/Catalog Number







Boster Bio Anti-AKR1B10 Antibody Picoband™ catalog # A02976. Tested in IHC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AKR1B10 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02976)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A02976 is reactive to AKR1B10 in Human


A02976 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For AKR1B10 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Aldo-keto reductase family 1 member B10




aldo/keto reductase family

Alternative Names

AKR1B10; AKR1B11; AKR1B12; Aldo-keto Reductase 1B10; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); AldoketoReductase 1B10; aldose reductase-like 1; aldose reductase-like peptide; Aldose reductase-like; Aldose reductase-related protein; ALDRLn; ARL1; ARL-1SI reductase; ARP; EC 1.1.1; EC 1.1.1.-; EC; hARP; HIS; HSI; MGC14103; Small intestine reductase AKR1B10 AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI aldo-keto reductase family 1 member B10 aldo-keto reductase family 1 member B10|ARP|SI reductase|aldo-keto reductase family 1, member B10 (aldose reductase)|aldo-keto reductase family 1, member B11 (aldose reductase-like)|aldose reductase-like 1|aldose reductase-like peptide|aldose reductase-related protein|hARP|small intestine reductase

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on AKR1B10, check out the AKR1B10 Infographic

AKR1B10 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for AKR1B10: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A02976

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-AKR1B10 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-AKR1B10 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-AKR1B10 Antibody Picoband™


Is there a BSA free version of anti-AKR1B10 antibody A02976 available?

Verified Customer

Verified customer

Asked: 2020-02-20


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AKR1B10 antibody A02976 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-20


Would anti-AKR1B10 antibody A02976 work for IHC with small intestine?

Verified Customer

Verified customer

Asked: 2019-12-17


According to the expression profile of small intestine, AKR1B10 is highly expressed in small intestine. So, it is likely that anti-AKR1B10 antibody A02976 will work for IHC with small intestine.

Boster Scientific Support

Answered: 2019-12-17


We are currently using anti-AKR1B10 antibody A02976 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-18


The anti-AKR1B10 antibody (A02976) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-18


My lab would like to test anti-AKR1B10 antibody A02976 on human small intestine for research purposes, then I may be interested in using anti-AKR1B10 antibody A02976 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-05


The products we sell, including anti-AKR1B10 antibody A02976, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-05


Is this A02976 anti-AKR1B10 antibody reactive to the isotypes of AKR1B10?

Verified Customer

Verified customer

Asked: 2018-01-16


The immunogen of A02976 anti-AKR1B10 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-01-16


Would anti-AKR1B10 antibody A02976 work on bovine WB with small intestine?

Verified Customer

Verified customer

Asked: 2017-06-02


Our lab technicians have not validated anti-AKR1B10 antibody A02976 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-AKR1B10 antibody A02976 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine small intestine in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-02


Does A02976 anti-AKR1B10 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

O. Zhang

Verified customer

Asked: 2014-08-11


As indicated on the product datasheet, A02976 anti-AKR1B10 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-08-11



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.