Product Info Summary
SKU: | A02976 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-AKR1B10 Antibody Picoband™
View all Aldo-keto Reductase 1B10/AKR1B10 Antibodies
SKU/Catalog Number
A02976
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-AKR1B10 Antibody Picoband™ catalog # A02976. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-AKR1B10 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02976)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A02976 is reactive to AKR1B10 in Human
Applications
A02976 is guaranteed for IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
36 kDa
Calculated molecular weight
36.02kDa
Background of Aldo-keto Reductase 1B10/AKR1B10
Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of AKR1B10 using anti-AKR1B10 antibody (A02976).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human A549 whole cell lysates,
Lane 2: human HepG2 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AKR1B10 antigen affinity purified polyclonal antibody (Catalog # A02976) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for AKR1B10 at approximately 36 kDa. The expected band size for AKR1B10 is at 36 kDa.
Click image to see more details
Figure 2. IHC analysis of AKR1B10 using anti-AKR1B10 antibody (A02976).
AKR1B10 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-AKR1B10 Antibody (A02976) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of AKR1B10 using anti-AKR1B10 antibody (A02976).
AKR1B10 was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-AKR1B10 Antibody (A02976) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IF analysis of AKR1B10 using anti-AKR1B10 antibody (A02976).
AKR1B10 was detected in an immunocytochemical section of A549 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 μg/mL rabbit anti-AKR1B10 Antibody (A02976) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For AKR1B10 (Source: Uniprot.org, NCBI)
Gene Name
AKR1B10
Full Name
Aldo-keto reductase family 1 member B10
Weight
36.02kDa
Superfamily
aldo/keto reductase family
Alternative Names
AKR1B10; AKR1B11; AKR1B12; Aldo-keto Reductase 1B10; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); AldoketoReductase 1B10; aldose reductase-like 1; aldose reductase-like peptide; Aldose reductase-like; Aldose reductase-related protein; ALDRLn; ARL1; ARL-1SI reductase; ARP; EC 1.1.1; EC 1.1.1.-; EC 1.1.1.21; hARP; HIS; HSI; MGC14103; Small intestine reductase AKR1B10 AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI aldo-keto reductase family 1 member B10 aldo-keto reductase family 1 member B10|ARP|SI reductase|aldo-keto reductase family 1, member B10 (aldose reductase)|aldo-keto reductase family 1, member B11 (aldose reductase-like)|aldose reductase-like 1|aldose reductase-like peptide|aldose reductase-related protein|hARP|small intestine reductase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AKR1B10, check out the AKR1B10 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AKR1B10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-AKR1B10 Antibody Picoband™ (A02976)
Hello CJ!
A02976 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Loss of AKR1B10 promotes colorectal cancer cells proliferation and migration via regulating FGF1-dependent pathway
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-AKR1B10 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-AKR1B10 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-AKR1B10 Antibody Picoband™
Question
Is there a BSA free version of anti-AKR1B10 antibody A02976 available?
Verified Customer
Verified customer
Asked: 2020-02-20
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AKR1B10 antibody A02976 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-20
Question
Would anti-AKR1B10 antibody A02976 work for IHC with small intestine?
Verified Customer
Verified customer
Asked: 2019-12-17
Answer
According to the expression profile of small intestine, AKR1B10 is highly expressed in small intestine. So, it is likely that anti-AKR1B10 antibody A02976 will work for IHC with small intestine.
Boster Scientific Support
Answered: 2019-12-17
Question
We are currently using anti-AKR1B10 antibody A02976 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2019-10-18
Answer
The anti-AKR1B10 antibody (A02976) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-10-18
Question
My lab would like to test anti-AKR1B10 antibody A02976 on human small intestine for research purposes, then I may be interested in using anti-AKR1B10 antibody A02976 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-06-05
Answer
The products we sell, including anti-AKR1B10 antibody A02976, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-06-05
Question
Is this A02976 anti-AKR1B10 antibody reactive to the isotypes of AKR1B10?
Verified Customer
Verified customer
Asked: 2018-01-16
Answer
The immunogen of A02976 anti-AKR1B10 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-01-16
Question
Would anti-AKR1B10 antibody A02976 work on bovine WB with small intestine?
Verified Customer
Verified customer
Asked: 2017-06-02
Answer
Our lab technicians have not validated anti-AKR1B10 antibody A02976 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-AKR1B10 antibody A02976 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine small intestine in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-06-02
Question
Does A02976 anti-AKR1B10 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
O. Zhang
Verified customer
Asked: 2014-08-11
Answer
As indicated on the product datasheet, A02976 anti-AKR1B10 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2014-08-11