Anti-Annexin VIII/ANXA8 Antibody Picoband™

Boster Bio Anti-Annexin VIII/ANXA8 Antibody Picoband™ catalog # A08645. Tested in Flow Cytometry, WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: A08645
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-Annexin VIII/ANXA8 Antibody Picoband™

See all Annexin A8/ANXA8 products

SKU/Catalog Number







Boster Bio Anti-Annexin VIII/ANXA8 Antibody Picoband™ catalog # A08645. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Annexin VIII/ANXA8 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A08645)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A08645 is reactive to ANXA8 in Human


A08645 is guaranteed for Flow Cytometry, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ANXA8 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Annexin A8




annexin family

Alternative Names

Annexin A8; Annexin VIII; Annexin-8; Anx8; ANXA8; ANXA8L2; FLJ53095; VAC-beta; Vascular anticoagulant-beta ANXA8 ANX8, CH17-360D5.2 annexin A8 annexin A8|VAC-beta|annexin VIII|annexin-8|vascular anticoagulant-beta

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ANXA8, check out the ANXA8 Infographic

ANXA8 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ANXA8: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A08645 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Anti-tumor activity of erlotinib in the BxPC-3 pancreatic cancer cell line

Have you used Anti-Annexin VIII/ANXA8 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Annexin VIII/ANXA8 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-Annexin VIII/ANXA8 Antibody Picoband™


See below the WB image, lot number and protocol we used for placenta using anti-Annexin VIII/ANXA8 antibody A08645. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-03-20


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-20


I have a question about product A08645, anti-Annexin VIII/ANXA8 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-17


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A08645 anti-Annexin VIII/ANXA8 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-17


We are currently using anti-Annexin VIII/ANXA8 antibody A08645 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-21


The anti-Annexin VIII/ANXA8 antibody (A08645) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-21


Total: $240

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.