Product Info Summary
SKU: | A07770-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Monkey, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-C1orf77/FOP/CHTOP Antibody Picoband™
SKU/Catalog Number
A07770-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-C1orf77/FOP/CHTOP Antibody Picoband™ catalog # A07770-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.
Storage & Handling
At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
Cite This Product
Anti-C1orf77/FOP/CHTOP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A07770-2)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence of human C1orf77/FOP/CHTOP (AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ).
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Reactive Species
A07770-2 is reactive to CHTOP in Human, Monkey, Mouse, Rat
Applications
A07770-2 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Background of CHTOP
This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.25-0.5 μg/ml, Human, Monkey, Mouse, Rat
Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human, Rat
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: monkey COS-7 whole cell lysates,
Lane 3: human THP-1 whole cell lysates,
Lane 4: human MOLT-4 whole cell lysates,
Lane 5: human RT4 whole cell lysates,
Lane 6: human HL-60 whole cell lysates,
Lane 7: human MCF-7 whole cell lysates,
Lane 8: rat brain tissue lysates,
Lane 9: rat PC-12 whole cell lysates,
Lane 10: mouse spleen tissue lysates,
Lane 11: mouse brain tissue lysates,
Lane 12: mouse lung tissue lysates,
Lane 13: mouse L929 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-C1orf77/FOP/CHTOP antigen affinity purified polyclonal antibody (Catalog # A07770-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for C1orf77/FOP/CHTOP at approximately 28 kDa. The expected band size for C1orf77/FOP/CHTOP is at 26 kDa.

Click image to see more details
A07770-2-CHTOP-primary-antibodies-IHC-testing-7.jpg

Click image to see more details
Figure 3. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.

Click image to see more details
Figure 4. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.

Click image to see more details
Figure 5. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.

Click image to see more details
Figure 6. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.

Click image to see more details
Figure 7. IHC analysis of C1orf77/FOP/CHTOP using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
C1orf77/FOP/CHTOP was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.

Click image to see more details
Figure 8. Flow Cytometry analysis of THP-1 cells using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
Overlay histogram showing THP-1 cells stained with A07770-2 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

Click image to see more details
Figure 9. Flow Cytometry analysis of RH35 cells using anti-C1orf77/FOP/CHTOP antibody (A07770-2).
Overlay histogram showing RH35 cells stained with A07770-2 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-C1orf77/FOP/CHTOP Antibody (A07770-2, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For CHTOP (Source: Uniprot.Org, NCBI)
Uniprot ID
Q9Y3Y2
Gene ID
26097
Gene Name
CHTOP
Full Name
Chromatin target of PRMT1 protein
Weight
26.397kDa
Alternative Names
C1orf77; chromatin target of PRMT1; DKFZP547E1010; FOPMGC86949; Friend of PRMT1 protein; MGC131924; pp7704; RP1-178F15.2; Small arginine- and glycine-rich protein; small protein rich in arginine and glycine; SRAGchromosome 1 open reading frame 77 CHTOP C10orf77, C1orf77, FL-SRAG, FOP, SRAG, SRAG-3, SRAG-5, pp7704 chromatin target of PRMT1 chromatin target of PRMT1 protein|friend of PRMT1 protein|small protein rich in arginine and glycine
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on CHTOP, check out the CHTOP Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for CHTOP: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-C1orf77/FOP/CHTOP Antibody Picoband™ (A07770-2)
No publications found for A07770-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-C1orf77/FOP/CHTOP Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-C1orf77/FOP/CHTOP Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question