Anti-C1orf77/FOP/CHTOP Antibody Picoband™

CHTOP antibody

Boster Bio Anti-C1orf77/FOP/CHTOP Antibody Picoband™ catalog # A07770-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Product Info Summary

SKU: A07770-2
Size: 100 μg/vial
Reactive Species: Human, Monkey, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-C1orf77/FOP/CHTOP Antibody Picoband™

View all CHTOP Antibodies

SKU/Catalog Number

A07770-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-C1orf77/FOP/CHTOP Antibody Picoband™ catalog # A07770-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Storage & Handling

At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.

Cite This Product

Anti-C1orf77/FOP/CHTOP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A07770-2)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human C1orf77/FOP/CHTOP (AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A07770-2 is reactive to CHTOP in Human, Monkey, Mouse, Rat

Applications

A07770-2 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Background of CHTOP

This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5 μg/ml, Human, Monkey, Mouse, Rat
Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For CHTOP (Source: Uniprot.Org, NCBI)

Uniprot ID

Q9Y3Y2

Gene ID

26097

Gene Name

CHTOP

Full Name

Chromatin target of PRMT1 protein

Weight

26.397kDa

Alternative Names

C1orf77; chromatin target of PRMT1; DKFZP547E1010; FOPMGC86949; Friend of PRMT1 protein; MGC131924; pp7704; RP1-178F15.2; Small arginine- and glycine-rich protein; small protein rich in arginine and glycine; SRAGchromosome 1 open reading frame 77 CHTOP C10orf77, C1orf77, FL-SRAG, FOP, SRAG, SRAG-3, SRAG-5, pp7704 chromatin target of PRMT1 chromatin target of PRMT1 protein|friend of PRMT1 protein|small protein rich in arginine and glycine

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CHTOP, check out the CHTOP Infographic

CHTOP infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CHTOP: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A07770-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-C1orf77/FOP/CHTOP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-C1orf77/FOP/CHTOP Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-C1orf77/FOP/CHTOP Antibody Picoband™

Size

Conjugation

how to order through PO

Total: $315

Size:100 μg

SKU:A07770-2

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A07770-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.