Anti-Caspase-2/CASP2 Antibody Picoband™

Boster Bio Anti-Caspase-2/CASP2 Antibody Picoband™ catalog # PB9368. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9368
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Caspase-2/CASP2 Antibody Picoband™

See all Caspase-2 products

SKU/Catalog Number







Boster Bio Anti-Caspase-2/CASP2 Antibody Picoband™ catalog # PB9368. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Caspase-2/CASP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9368)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2 (378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9368 is reactive to CASP2 in Human, Mouse, Rat


PB9368 is guaranteed for WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For CASP2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name





peptidase C14A family

Alternative Names

caspase-2; CASP2; CASP-2; caspase 2, apoptosis-related cysteine peptidase; Caspase2; Caspase-2; ICH1; ICH-1; NEDD2; NEDD-2; PPP1R57 CASP2 CASP-2, ICH1, NEDD-2, NEDD2, PPP1R57 caspase 2 caspase-2|caspase 2 apoptosis-related cysteine peptidase|neural precursor cell expressed developmentally down-regulated protein 2|protease ICH-1|protein phosphatase 1, regulatory subunit 57

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CASP2, check out the CASP2 Infographic

CASP2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CASP2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9368

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Caspase-2/CASP2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Caspase-2/CASP2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-Caspase-2/CASP2 Antibody Picoband™


We are currently using anti-Caspase-2/CASP2 antibody PB9368 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2017-05-11


The anti-Caspase-2/CASP2 antibody (PB9368) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-05-11


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.