Click image to see more details
Product Info Summary
| SKU: | A00031 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CXCR4 Antibody Picoband®
SKU/Catalog Number
A00031
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CXCR4 Antibody Picoband® catalog # A00031. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CXCR4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00031)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4, different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00031 is reactive to CXCR4 in Human
Observed Molecular Weight
40 kDa
Calculated molecular weight
39.7 kDa
Background of CXCR4
CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00031 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: HELA whole Cell
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of CXCR4 using anti-CXCR4 antibody (A00031).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HELA whole Cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CXCR4 antigen affinity purified polyclonal antibody (Catalog # A00031) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CXCR4 at approximately 40KD. The expected band size for CXCR4 is at 40KD.
Specific Publications For Anti-CXCR4 Antibody Picoband® (A00031)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CXCR4 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-CXCR4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-CXCR4 Antibody Picoband®
Question
Is a blocking peptide available for product anti-CXCR4 antibody (A00031)?
Verified Customer
Verified customer
Asked: 2020-05-07
Answer
We do provide the blocking peptide for product anti-CXCR4 antibody (A00031). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2020-05-07
Question
Does A00031 anti-CXCR4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-05-01
Answer
You can see on the product datasheet, A00031 anti-CXCR4 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-05-01
Question
We are currently using anti-CXCR4 antibody A00031 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-11-05
Answer
The anti-CXCR4 antibody (A00031) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-11-05
Question
I was wanting to use your anti-CXCR4 antibody for WB for human peripheral blood leukocyte on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human peripheral blood leukocyte identification?
Verified Customer
Verified customer
Asked: 2019-08-28
Answer
As indicated on the product datasheet, A00031 anti-CXCR4 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human peripheral blood leukocyte in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-08-28
Question
I have a question about product A00031, anti-CXCR4 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-06-07
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00031 anti-CXCR4 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-06-07
Question
Is this A00031 anti-CXCR4 antibody reactive to the isotypes of CXCR4?
Verified Customer
Verified customer
Asked: 2019-06-06
Answer
The immunogen of A00031 anti-CXCR4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-06-06
Question
I see that the anti-CXCR4 antibody A00031 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-05-31
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-05-31
Question
Our team were happy with the WB result of your anti-CXCR4 antibody. However we have observed positive staining in adrenal gland cell membrane using this antibody. Is that expected? Could you tell me where is CXCR4 supposed to be expressed?
J. Carter
Verified customer
Asked: 2019-02-05
Answer
According to literature, adrenal gland does express CXCR4. Generally CXCR4 expresses in cell membrane. Regarding which tissues have CXCR4 expression, here are a few articles citing expression in various tissues:
Adrenal gland, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 20068231, 23186163
Colon, Pubmed ID: 15489334
Fetal brain, Pubmed ID: 8234909
Fetal spleen, Pubmed ID: 8325644
Lung, Pubmed ID: 8329116, 15815621
Monocyte, Pubmed ID: 8276799
Boster Scientific Support
Answered: 2019-02-05
Question
Does anti-CXCR4 antibody A00031 work for WB with peripheral blood leukocyte?
Verified Customer
Verified customer
Asked: 2018-10-02
Answer
According to the expression profile of peripheral blood leukocyte, CXCR4 is highly expressed in peripheral blood leukocyte. So, it is likely that anti-CXCR4 antibody A00031 will work for WB with peripheral blood leukocyte.
Boster Scientific Support
Answered: 2018-10-02
Question
I have attached the WB image, lot number and protocol we used for peripheral blood leukocyte using anti-CXCR4 antibody A00031. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-06-08
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-08
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for peripheral blood leukocyte using anti-CXCR4 antibody A00031. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2017-09-26
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-09-26
Question
I would like using your anti-CXCR4 antibody for entry into host cell studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-09-01
Answer
I appreciate your inquiry. This A00031 anti-CXCR4 antibody is tested on hela whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-09-01
Question
I was wanting to use to test anti-CXCR4 antibody A00031 on human peripheral blood leukocyte for research purposes, then I may be interested in using anti-CXCR4 antibody A00031 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
N. Krishna
Verified customer
Asked: 2016-08-25
Answer
The products we sell, including anti-CXCR4 antibody A00031, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2016-08-25
Question
We have been able to see staining in human fetal spleen. Do you have any suggestions? Is anti-CXCR4 antibody supposed to stain fetal spleen positively?
G. Edwards
Verified customer
Asked: 2013-12-24
Answer
From literature fetal spleen does express CXCR4. From Uniprot.org, CXCR4 is expressed in oviduct epithelium, lung, fetal brain, fetal spleen, monocyte, peripheral blood leukocyte, peripheral blood lymphocyte, neutrophil, adrenal gland, colon, cervix carcinoma, among other tissues. Regarding which tissues have CXCR4 expression, here are a few articles citing expression in various tissues:
Adrenal gland, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 20068231, 23186163
Colon, Pubmed ID: 15489334
Fetal brain, Pubmed ID: 8234909
Fetal spleen, Pubmed ID: 8325644
Lung, Pubmed ID: 8329116, 15815621
Monocyte, Pubmed ID: 8276799
Boster Scientific Support
Answered: 2013-12-24
Question
Do you have a BSA free version of anti-CXCR4 antibody A00031 available?
A. Carter
Verified customer
Asked: 2013-10-25
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-CXCR4 antibody A00031 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2013-10-25
