Anti-CXCR4 Antibody Picoband™

CXCR4 antibody

Boster Bio Anti-CXCR4 Antibody Picoband™ catalog # A00031. Tested in WB applications. This antibody reacts with Human. Cited in 5 publication(s).

Product Info Summary

SKU: A00031
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-CXCR4 Antibody Picoband™

View all CXCR4 Antibodies

SKU/Catalog Number

A00031

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CXCR4 Antibody Picoband™ catalog # A00031. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CXCR4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00031)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4, different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00031 is reactive to CXCR4 in Human

Applications

A00031 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

40 kDa

Calculated molecular weight

39.746kDa

Background of CXCR4

CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For CXCR4 (Source: Uniprot.org, NCBI)

Gene Name

CXCR4

Full Name

C-X-C chemokine receptor type 4

Weight

39.746kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

CD184; chemokine (C-X-C motif) receptor 4; chemokine (C-X-C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CXCR4; CXC-R4; CXCR-4; D2S201E; D2S201ESDF-1 receptor; FB22; Fusin; HM89; HM89NPYRL; HSY3RR; LAP3; LAP-3; LCR1; LESTR; LESTRCD184 antigen; Leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; lipopolysaccharide-associated protein 3; neuropeptide Y receptor Y3; NPY3R; NPY3RWHIM; NPYR; NPYRL; NPYY3R; seven transmembrane helix receptor; seven-transmembrane-segment receptor, spleen; Stromal cell-derived factor 1 receptor; CXCR4 CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS C-X-C motif chemokine receptor 4 C-X-C chemokine receptor type 4|CD184 antigen|LPS-associated protein 3|SDF-1 receptor|chemokine (C-X-C motif) receptor 4|fusin|leukocyte-derived seven transmembrane domain receptor|lipopolysaccharide-associated protein 3|neuropeptide Y receptor Y3|neuropeptide Y3 receptor|seven transmembrane helix receptor|seven-transmembrane-segment receptor, spleen|stromal cell-derived factor 1 receptor

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CXCR4, check out the CXCR4 Infographic

CXCR4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCR4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00031 has been cited in 5 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Liu Y,Feng Q,Miao J,Wu Q,Zhou S,Shen W,Feng Y,Hou FF,Liu Y,Zhou L.C-X-C motif chemokine receptor 4 aggravates renal fibrosis through activating JAK/STAT/GSK3β/β-catenin pathway.J Cell Mol Med.2020 Apr;24(7):3837-3855.doi:10.1111/jcmm.14973.Epub 2020 Mar 2.PMID:32119183;PMCID:PMC7171406.
Species: Human,Mouse
A00031 usage in article: APP:WB, SAMPLE:HKC-8 CELL, DILUTION:NA

Macrophage migration inhibitory factor%u2013CXCR4 is the dominant chemotactic axis in human mesenchymal stem cell recruitment to tumors

Chemokine CXCL12 and its receptor CXCR4 expression are associated with perineural invasion of prostate cancer

Blockade of CXCL12/CXCR4 signaling inhibits intrahepatic cholangiocarcinoma progression and metastasis via inactivation of canonical Wnt pathway

Tacrolimus promotes hepatocellular carcinoma and enhances CXCR4/SDF-1? expression?in vivo

Have you used Anti-CXCR4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CXCR4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-CXCR4 Antibody Picoband™

Question

Is a blocking peptide available for product anti-CXCR4 antibody (A00031)?

Verified Customer

Verified customer

Asked: 2020-05-07

Answer

We do provide the blocking peptide for product anti-CXCR4 antibody (A00031). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-05-07

Question

Does A00031 anti-CXCR4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

You can see on the product datasheet, A00031 anti-CXCR4 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-05-01

Question

We are currently using anti-CXCR4 antibody A00031 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-11-05

Answer

The anti-CXCR4 antibody (A00031) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-05

Question

I was wanting to use your anti-CXCR4 antibody for WB for human peripheral blood leukocyte on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human peripheral blood leukocyte identification?

Verified Customer

Verified customer

Asked: 2019-08-28

Answer

As indicated on the product datasheet, A00031 anti-CXCR4 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human peripheral blood leukocyte in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-28

Question

I have a question about product A00031, anti-CXCR4 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-06-07

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00031 anti-CXCR4 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-06-07

Question

Is this A00031 anti-CXCR4 antibody reactive to the isotypes of CXCR4?

Verified Customer

Verified customer

Asked: 2019-06-06

Answer

The immunogen of A00031 anti-CXCR4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-06

Question

I see that the anti-CXCR4 antibody A00031 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-05-31

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-05-31

Question

Our team were happy with the WB result of your anti-CXCR4 antibody. However we have observed positive staining in adrenal gland cell membrane using this antibody. Is that expected? Could you tell me where is CXCR4 supposed to be expressed?

J. Carter

Verified customer

Asked: 2019-02-05

Answer

According to literature, adrenal gland does express CXCR4. Generally CXCR4 expresses in cell membrane. Regarding which tissues have CXCR4 expression, here are a few articles citing expression in various tissues:
Adrenal gland, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 20068231, 23186163
Colon, Pubmed ID: 15489334
Fetal brain, Pubmed ID: 8234909
Fetal spleen, Pubmed ID: 8325644
Lung, Pubmed ID: 8329116, 15815621
Monocyte, Pubmed ID: 8276799

Boster Scientific Support

Answered: 2019-02-05

Question

Does anti-CXCR4 antibody A00031 work for WB with peripheral blood leukocyte?

Verified Customer

Verified customer

Asked: 2018-10-02

Answer

According to the expression profile of peripheral blood leukocyte, CXCR4 is highly expressed in peripheral blood leukocyte. So, it is likely that anti-CXCR4 antibody A00031 will work for WB with peripheral blood leukocyte.

Boster Scientific Support

Answered: 2018-10-02

Question

I have attached the WB image, lot number and protocol we used for peripheral blood leukocyte using anti-CXCR4 antibody A00031. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-06-08

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-08

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for peripheral blood leukocyte using anti-CXCR4 antibody A00031. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2017-09-26

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-09-26

Question

I would like using your anti-CXCR4 antibody for entry into host cell studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-09-01

Answer

I appreciate your inquiry. This A00031 anti-CXCR4 antibody is tested on hela whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-09-01

Question

I was wanting to use to test anti-CXCR4 antibody A00031 on human peripheral blood leukocyte for research purposes, then I may be interested in using anti-CXCR4 antibody A00031 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

N. Krishna

Verified customer

Asked: 2016-08-25

Answer

The products we sell, including anti-CXCR4 antibody A00031, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2016-08-25

Question

We have been able to see staining in human fetal spleen. Do you have any suggestions? Is anti-CXCR4 antibody supposed to stain fetal spleen positively?

G. Edwards

Verified customer

Asked: 2013-12-24

Answer

From literature fetal spleen does express CXCR4. From Uniprot.org, CXCR4 is expressed in oviduct epithelium, lung, fetal brain, fetal spleen, monocyte, peripheral blood leukocyte, peripheral blood lymphocyte, neutrophil, adrenal gland, colon, cervix carcinoma, among other tissues. Regarding which tissues have CXCR4 expression, here are a few articles citing expression in various tissues:
Adrenal gland, Pubmed ID: 14702039
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 20068231, 23186163
Colon, Pubmed ID: 15489334
Fetal brain, Pubmed ID: 8234909
Fetal spleen, Pubmed ID: 8325644
Lung, Pubmed ID: 8329116, 15815621
Monocyte, Pubmed ID: 8276799

Boster Scientific Support

Answered: 2013-12-24

Question

Do you have a BSA free version of anti-CXCR4 antibody A00031 available?

A. Carter

Verified customer

Asked: 2013-10-25

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-CXCR4 antibody A00031 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-10-25

Order DetailsPrice
A00031

100μg

$370
A00031-10ug

10μg sample (liquid)

$99
A00031-Biotin

100 μg Biotin conjugated

$570
A00031-Cy3

100 μg Cy3 conjugated

$570
A00031-Dylight488

100 μg Dylight488 conjugated

$570
A00031-Dylight550

100 μg Dylight550 conjugated

$570
A00031-Dylight594

100 μg Dylight594 conjugated

$570
A00031-FITC

100 μg FITC conjugated

$570
A00031-HRP

100 μg HRP conjugated

$570
A00031-APC

100 μg APC conjugated

$670
A00031-PE

100 μg PE conjugated

$670
A00031-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
A00031
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.