Overview
Product Name |
Anti-Dishevelled 3/DVL3 Antibody Picoband™
See more Dishevelled-3 products |
Catalog# |
A03577 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-Dishevelled 3/DVL3 Antibody Picoband™ catalog # A03577. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-Dishevelled 3/DVL3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03577)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-Dishevelled 3/DVL3 Antibody Picoband™ may replace the following items: sc 26506|sc 26504|sc 28846|sc 271295|sc 377289|sc 365581|sc 8027. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human, Mouse, Rat |
Applications |
WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence. |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For DVL3 (Source: Uniprot.org, NCBI)
Uniprot Id | Q92997 |
---|
NCBI Gene Id | 1857 |
---|
Species Of This Entry | Human |
---|
Gene Name | DVL3 |
---|
Protein Name | Segment polarity protein dishevelled homolog DVL-3 |
---|
Superfamily | DSH family |
---|
Alternative Names | Dishevelled-3|dishevelled 3 (homologous to Drosophila dsh); dishevelled, dsh homolog 3 (Drosophila); Dishevelled3; Dishevelled-3; DSH homolog 3; DVL3; KIAA0208dishevelled-3; segment polarity protein dishevelled homolog DVL-3 |
---|
Molecular Weight | 78055 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on DVL3, check out the DVL3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for DVL3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the DVL3 infographic
Our Boster Quality Guarantee for Anti-Dishevelled 3/DVL3 Antibody Picoband™ covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of Dishevelled 3 using anti-Dishevelled 3 antibody (A03577).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Dishevelled 3 antigen affinity purified polyclonal antibody (Catalog # A03577) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Dishevelled 3 at approximately 78KD. The expected band size for Dishevelled 3 is at 78KD.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A03577 Anti-Dishevelled 3/DVL3 Antibody Picoband™
6 Related Questions
Question
Is this A03577 anti-Dishevelled 3/DVL3 antibody reactive to the isotypes of DVL3?
Verified Customer
Asked: 2020-01-22
Answer
The immunogen of A03577 anti-Dishevelled 3/DVL3 antibody is A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-22
Question
My question regarding product A03577, anti-Dishevelled 3/DVL3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Asked: 2019-10-10
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03577 anti-Dishevelled 3/DVL3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-10
Question
I have attached the WB image, lot number and protocol we used for brain using anti-Dishevelled 3/DVL3 antibody A03577. Please let me know if you require anything else.
Verified Customer
Asked: 2019-06-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-28
Question
We are currently using anti-Dishevelled 3/DVL3 antibody A03577 for rat tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on primate tissues as well?
Verified Customer
Asked: 2019-05-22
Answer
The anti-Dishevelled 3/DVL3 antibody (A03577) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-22
Question
I was wanting to use to test anti-Dishevelled 3/DVL3 antibody A03577 on mouse brain for research purposes, then I may be interested in using anti-Dishevelled 3/DVL3 antibody A03577 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Asked: 2018-09-20
Answer
The products we sell, including anti-Dishevelled 3/DVL3 antibody A03577, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-09-20
Question
Does anti-Dishevelled 3/DVL3 antibody A03577 work for WB with brain?
R. Parker
Asked: 2013-07-05
Answer
According to the expression profile of brain, DVL3 is highly expressed in brain. So, it is likely that anti-Dishevelled 3/DVL3 antibody A03577 will work for WB with brain.
Boster Scientific Support
Answered: 2013-07-05