Anti-Dishevelled 3/DVL3 Antibody Picoband™

Product Name

Anti-Dishevelled 3/DVL3 Antibody Picoband™

View all Dishevelled-3 Antibodies

SKU/Catalog Number

A03577

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Dishevelled 3/DVL3 Antibody Picoband™ catalog # A03577. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Dishevelled 3/DVL3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03577)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03577 is reactive to DVL3 in Human, Mouse, Rat

Applications

A03577 is guaranteed for WB Boster Guarantee

Background of Dishevelled-3

Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Click image to see more details

Figure 1. Western blot analysis of Dishevelled 3 using anti-Dishevelled 3 antibody (A03577).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Dishevelled 3 antigen affinity purified polyclonal antibody (Catalog # A03577) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Dishevelled 3 at approximately 78KD. The expected band size for Dishevelled 3 is at 78KD.

Gene/Protein Information For DVL3 (Source: Uniprot.org, NCBI)

Alternative Names

dishevelled 3 (homologous to Drosophila dsh); dishevelled, dsh homolog 3 (Drosophila); Dishevelled3; Dishevelled-3; DSH homolog 3; DVL3; KIAA0208dishevelled-3; segment polarity protein dishevelled homolog DVL-3 DVL3 DRS3 dishevelled segment polarity protein 3 segment polarity protein dishevelled homolog DVL-3|dishevelled 3 (homologous to Drosophila dsh)|dishevelled, dsh homolog 3

For more info on DVL3, check out the DVL3 Infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DVL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

Take me to the DVL3 Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis