Anti-Dishevelled 3/DVL3 Antibody Picoband™

Dishevelled-3 antibody

Boster Bio Anti-Dishevelled 3/DVL3 Antibody Picoband™ catalog # A03577. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A03577
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Dishevelled 3/DVL3 Antibody Picoband™

View all Dishevelled-3 Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-Dishevelled 3/DVL3 Antibody Picoband™ catalog # A03577. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Dishevelled 3/DVL3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03577)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03577 is reactive to DVL3 in Human, Mouse, Rat


A03577 is guaranteed for WB Boster Guarantee

Background of Dishevelled-3

Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For DVL3 (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Segment polarity protein dishevelled homolog DVL-3




DSH family

Alternative Names

dishevelled 3 (homologous to Drosophila dsh); dishevelled, dsh homolog 3 (Drosophila); Dishevelled3; Dishevelled-3; DSH homolog 3; DVL3; KIAA0208dishevelled-3; segment polarity protein dishevelled homolog DVL-3 DVL3 DRS3 dishevelled segment polarity protein 3 segment polarity protein dishevelled homolog DVL-3|dishevelled 3 (homologous to Drosophila dsh)|dishevelled, dsh homolog 3

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on DVL3, check out the DVL3 Infographic

DVL3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DVL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A03577

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Dishevelled 3/DVL3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Dishevelled 3/DVL3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-Dishevelled 3/DVL3 Antibody Picoband™


Is this A03577 anti-Dishevelled 3/DVL3 antibody reactive to the isotypes of DVL3?

Verified Customer

Verified customer

Asked: 2020-01-22


The immunogen of A03577 anti-Dishevelled 3/DVL3 antibody is A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-22


My question regarding product A03577, anti-Dishevelled 3/DVL3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-10-10


We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03577 anti-Dishevelled 3/DVL3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-10


I have attached the WB image, lot number and protocol we used for brain using anti-Dishevelled 3/DVL3 antibody A03577. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-28


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-28


We are currently using anti-Dishevelled 3/DVL3 antibody A03577 for rat tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-05-22


The anti-Dishevelled 3/DVL3 antibody (A03577) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-05-22


I was wanting to use to test anti-Dishevelled 3/DVL3 antibody A03577 on mouse brain for research purposes, then I may be interested in using anti-Dishevelled 3/DVL3 antibody A03577 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-09-20


The products we sell, including anti-Dishevelled 3/DVL3 antibody A03577, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-09-20


Does anti-Dishevelled 3/DVL3 antibody A03577 work for WB with brain?

R. Parker

Verified customer

Asked: 2013-07-05


According to the expression profile of brain, DVL3 is highly expressed in brain. So, it is likely that anti-Dishevelled 3/DVL3 antibody A03577 will work for WB with brain.

Boster Scientific Support

Answered: 2013-07-05



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.