Anti-Dishevelled 2/DVL2 Antibody Picoband™

Boster Bio Anti-Dishevelled 2/DVL2 Antibody Picoband™ catalog # A02404-3. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A02404-3
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Dishevelled 2/DVL2 Antibody Picoband™

See all Dishevelled-2 products

SKU/Catalog Number







Boster Bio Anti-Dishevelled 2/DVL2 Antibody Picoband™ catalog # A02404-3. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Dishevelled 2/DVL2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02404-3)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A02404-3 is reactive to DVL2 in Human, Mouse, Rat


A02404-3 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For DVL2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Segment polarity protein dishevelled homolog DVL-2




DSH family

Alternative Names

dishevelled 2 (homologous to Drosophila dsh); dishevelled, dsh homolog 2 (Drosophila); Dishevelled2; Dishevelled-2; DSH homolog 2; DVL2; segment polarity protein dishevelled homolog DVL-2 DVL2 dishevelled segment polarity protein 2 segment polarity protein dishevelled homolog DVL-2|dishevelled 2 (homologous to Drosophila dsh)|dishevelled, dsh homolog 2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on DVL2, check out the DVL2 Infographic

DVL2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for DVL2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A02404-3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Dishevelled 2/DVL2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Dishevelled 2/DVL2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-Dishevelled 2/DVL2 Antibody Picoband™


My question regarding product A02404-3, anti-Dishevelled 2/DVL2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-01-16


We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A02404-3 anti-Dishevelled 2/DVL2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-01-16


I was wanting to use your anti-Dishevelled 2/DVL2 antibody for WB for mouse liver on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse liver identification?

Verified Customer

Verified customer

Asked: 2019-10-04


It shows on the product datasheet, A02404-3 anti-Dishevelled 2/DVL2 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-04


We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-Dishevelled 2/DVL2 antibody A02404-3. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-10-01


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-01


Will anti-Dishevelled 2/DVL2 antibody A02404-3 work on pig WB with vagina?

R. Anderson

Verified customer

Asked: 2019-09-24


Our lab technicians have not validated anti-Dishevelled 2/DVL2 antibody A02404-3 on pig. You can run a BLAST between pig and the immunogen sequence of anti-Dishevelled 2/DVL2 antibody A02404-3 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig vagina in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-24


We are currently using anti-Dishevelled 2/DVL2 antibody A02404-3 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2017-12-27


The anti-Dishevelled 2/DVL2 antibody (A02404-3) has not been validated for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-12-27


I see that the anti-Dishevelled 2/DVL2 antibody A02404-3 works with WB, what is the protocol used to produce the result images on the product page?

R. Patel

Verified customer

Asked: 2016-05-13


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2016-05-13


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.