Anti-ELAVL4 Antibody Picoband™

Boster Bio Anti-ELAVL4 Antibody Picoband™ catalog # PB9698. Tested in IF, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9698
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC-P, WB

Product Name

Anti-ELAVL4 Antibody Picoband™

See all ELAVL4 products

SKU/Catalog Number

PB9698

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ELAVL4 Antibody Picoband™ catalog # PB9698. Tested in IF, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ELAVL4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9698)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9698 is reactive to ELAVL4 in Human, Mouse, Rat

Applications

PB9698 is guaranteed for IF, IHC-P, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunofluorescence, 2μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ELAVL4 (Source: Uniprot.Org, NCBI)

Uniprot ID

P26378

Gene ID

1996

Gene Name

ELAVL4

Full Name

ELAV-like protein 4

Weight

42.398kDa

Superfamily

RRM elav family

Alternative Names

abnormal vision, Drosophila, homolog of, like-4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HuD; Paraneoplastic encephalomyelitis antigen HuD ELAVL4 HUD, PNEM ELAV like RNA binding protein 4 ELAV-like protein 4|ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)|ELAV like neuron-specific RNA binding protein 4|Hu antigen D|paraneoplastic encephalomyelitis antigen HuD

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ELAVL4, check out the ELAVL4 Infographic

ELAVL4 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ELAVL4: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9698

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ELAVL4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ELAVL4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-ELAVL4 Antibody Picoband™

Question

Can the ratio/concentration of sodium azide in the lyophilized product PB9698 be determined?

Verified customer

Asked: 2020-06-22

Answer

Lyophilized Anti-ELAVL4 Antibody Picoband™ (PB9698) contains 0.3% sodium azide.

Boster Scientific Support

Answered: 2020-06-23

Question

I have a question about product PB9698, anti-ELAVL4 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-11-07

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9698 anti-ELAVL4 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-07

Question

We are currently using anti-ELAVL4 antibody PB9698 for mouse tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?

R. Zhang

Verified customer

Asked: 2015-12-23

Answer

The anti-ELAVL4 antibody (PB9698) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-12-23

Question

Is this PB9698 anti-ELAVL4 antibody reactive to the isotypes of ELAVL4?

J. Huang

Verified customer

Asked: 2014-03-13

Answer

The immunogen of PB9698 anti-ELAVL4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-03-13

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9698
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.