Anti-ETS1 Antibody Picoband™

Boster Bio Anti-ETS1 Antibody Picoband™ catalog # A00931-2. Tested in WB applications. This antibody reacts with Human, Mouse. Cited in 1 publication(s).

Product Info Summary

SKU: A00931-2
Size: 100μg/vial
Reactive Species: Human, Mouse
Host: Rabbit
Application: WB

Product Name

Anti-ETS1 Antibody Picoband™

See all Ets-1 products

SKU/Catalog Number







Boster Bio Anti-ETS1 Antibody Picoband™ catalog # A00931-2. Tested in WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ETS1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00931-2)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00931-2 is reactive to ETS1 in Human, Mouse


A00931-2 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For ETS1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Protein C-ets-1




ETS family

Alternative Names

Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; ets protein; Ets1; Ets-1; EWSR2; FLJ10768; p54; Protein C-Ets-1; v-ets avian erythroblastosis virus E2 oncogene homolog 1; v-ets avian erythroblastosis virus E26 oncogene homolog 1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); v-ets ETS1 ETS-1, EWSR2, c-ets-1, p54 ETS proto-oncogene 1, transcription factor protein C-ets-1|Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1|v-ets avian erythroblastosis virus E2 oncogene homolog 1|v-ets avian erythroblastosis virus E26 oncogene homolog 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ETS1, check out the ETS1 Infographic

ETS1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ETS1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00931-2 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p

Have you used Anti-ETS1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ETS1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-ETS1 Antibody Picoband™


My colleagues were happy with the WB result of your anti-ETS1 antibody. However we have observed positive staining in blood cytoplasm. using this antibody. Is that expected? Could you tell me where is ETS1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-04-02


According to literature, blood does express ETS1. Generally ETS1 expresses in cytoplasm. Regarding which tissues have ETS1 expression, here are a few articles citing expression in various tissues:
Endometrium, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Lung, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-04-02


I see that the anti-ETS1 antibody A00931-2 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-03-17


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-03-17


Is a blocking peptide available for product anti-ETS1 antibody (A00931-2)?

Verified Customer

Verified customer

Asked: 2019-12-09


We do provide the blocking peptide for product anti-ETS1 antibody (A00931-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-09


Please see the WB image, lot number and protocol we used for blood using anti-ETS1 antibody A00931-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-10-24


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-24


We have seen staining in mouse endometrium. Are there any suggestions? Is anti-ETS1 antibody supposed to stain endometrium positively?

Verified Customer

Verified customer

Asked: 2019-10-01


Based on literature endometrium does express ETS1. Based on, ETS1 is expressed in blood, endometrium, lung, leukemic t-cell, erythroleukemia, among other tissues. Regarding which tissues have ETS1 expression, here are a few articles citing expression in various tissues:
Endometrium, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Lung, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-10-01


Does anti-ETS1 antibody A00931-2 work for WB with blood?

Verified Customer

Verified customer

Asked: 2019-08-20


According to the expression profile of blood, ETS1 is highly expressed in blood. So, it is likely that anti-ETS1 antibody A00931-2 will work for WB with blood.

Boster Scientific Support

Answered: 2019-08-20


I was wanting to use your anti-ETS1 antibody for WB for mouse blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse blood identification?

Verified Customer

Verified customer

Asked: 2019-07-15


You can see on the product datasheet, A00931-2 anti-ETS1 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse blood in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-07-15


We want to test anti-ETS1 antibody A00931-2 on mouse blood for research purposes, then I may be interested in using anti-ETS1 antibody A00931-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-02


The products we sell, including anti-ETS1 antibody A00931-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-02


Is there a BSA free version of anti-ETS1 antibody A00931-2 available?

Verified Customer

Verified customer

Asked: 2019-04-23


I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ETS1 antibody A00931-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-04-23


My question regarding product A00931-2, anti-ETS1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-04-19


It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00931-2 anti-ETS1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-04-19


We are interested in using your anti-ETS1 antibody for positive regulation of cell population proliferation studies. Has this antibody been tested with western blotting on nih3t3 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-11-30


We appreciate your inquiry. This A00931-2 anti-ETS1 antibody is validated on nih3t3 whole cell lysates. It is guaranteed to work for WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-11-30


Would A00931-2 anti-ETS1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-09-14


You can see on the product datasheet, A00931-2 anti-ETS1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-09-14


We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for blood using anti-ETS1 antibody A00931-2. Let me know if you need anything else.

C. Parker

Verified customer

Asked: 2016-02-24


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-02-24


Is this A00931-2 anti-ETS1 antibody reactive to the isotypes of ETS1?

K. Yang

Verified customer

Asked: 2015-03-03


The immunogen of A00931-2 anti-ETS1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-03-03


We are currently using anti-ETS1 antibody A00931-2 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it possible that the antibody can work on horse tissues as well?

C. Collins

Verified customer

Asked: 2013-12-31


The anti-ETS1 antibody (A00931-2) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-12-31


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.