Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™

CXCR7/RDC-1 antibody

Boster Bio Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™ catalog # A02656-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A02656-2
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™

View all CXCR7/RDC-1 Antibodies

SKU/Catalog Number

A02656-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™ catalog # A02656-2. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human.

Storage & Handling

At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.

Cite This Product

Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02656-2)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence of human GPCR RDC1/CXCR-7/ACKR3 (RNYRYELMKAFIFKYSAKTGLTKLIDASRVSE).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A02656-2 is reactive to ACKR3 in Human

Applications

A02656-2 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Background of CXCR7/RDC-1

Atypical chemokine receptor 3 also known as C-X-C chemokine receptor type 7 (CXCR-7) and G-protein coupled receptor 159 (GPR159) is a protein that in humans is encoded by the ACKR3 gene. This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5 µg/ml, Human
Immunohistochemistry(Paraffin-embedded Section), 2-5 µg/ml, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ACKR3 (Source: Uniprot.org, NCBI)

Uniprot ID

P25106

Gene ID

57007

Gene Name

ACKR3

Full Name

Atypical chemokine receptor 3

Weight

41.493kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

ACKR3; chemokine (C-X-C motif) receptor 7; Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7; CMKOR1; CXCR7; CXC-R7; CXCR-7; G protein-coupled receptor; GPR159; GPR159G-protein coupled receptor 159; RDC-1; RDC1G-protein coupled receptor RDC1 homolog ACKR3 CMKOR1, CXC-R7, CXCR-7, CXCR7, GPR159, RDC-1, RDC1 atypical chemokine receptor 3 atypical chemokine receptor 3|C-X-C chemokine receptor type 7|G protein-coupled receptor|G-protein coupled receptor 159|G-protein coupled receptor RDC1 homolog|chemokine (C-X-C motif) receptor 7|chemokine orphan receptor 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ACKR3, check out the ACKR3 Infographic

ACKR3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACKR3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A02656-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-GPCR RDC1/CXCR-7/ACKR3 Antibody Picoband™

Size

Conjugation

Total: $315

SKU:A02656-2

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A02656-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.