Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™

GSTA1 antibody

Boster Bio Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™ catalog # PB9627. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9627
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™

View all GSTA1 Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™ catalog # PB9627. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9627)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9627 is reactive to GSTA1 in Human, Mouse, Rat


PB9627 is guaranteed for IF, IHC, WB Boster Guarantee

Background of GSTA1

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Mouse, Rat
Immunofluorescence, 2μg/ml, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For GSTA1 (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Glutathione S-transferase A1




GST superfamily

Alternative Names

EC; glutathione S-alkyltransferase A1; glutathione S-aryltransferase A1; glutathione S-transferase 2; glutathione S-transferase A1; glutathione S-transferase alpha 1; glutathione S-transferase Ha subunit 1; GST class-alpha member 1; GST HA subunit 1; GST, class alpha, 1; GST2; GSTA1-1; GST-epsilon; GTH1; MGC131939; S-(hydroxyalkyl)glutathione lyase A1 GSTA1 GST-epsilon, GST2-1, GTH1, GSTA1 glutathione S-transferase alpha 1 glutathione S-transferase A1|13-hydroperoxyoctadecadienoate peroxidase|GST HA subunit 1|GST class-alpha member 1|S-(hydroxyalkyl)glutathione lyase A1|androst-5-ene-3,17-dione isomerase|glutathione S-alkyltransferase A1|glutathione S-aryltransferase A1|glutathione S-transferase 2|glutathione S-transferase Ha subunit 1|testicular tissue protein Li 80

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on GSTA1, check out the GSTA1 Infographic

GSTA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GSTA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for PB9627

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband™


We are currently using anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 antibody PB9627 for human tissue, and we are satisfied with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-20


The anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 antibody (PB9627) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-20



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.