Anti-HECTD3 Antibody Picoband™

Boster Bio Anti-HECTD3 Antibody Picoband™ catalog # A11560. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A11560
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB

Product Name

Anti-HECTD3 Antibody Picoband™

See all HECTD3 products

SKU/Catalog Number







Boster Bio Anti-HECTD3 Antibody Picoband™ catalog # A11560. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HECTD3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A11560)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human HECTD3 (HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A11560 is reactive to HECTD3 in Human, Mouse, Rat


A11560 is guaranteed for Flow Cytometry, IHC-P, IHC-F, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For HECTD3 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

E3 ubiquitin-protein ligase HECTD3



Alternative Names

E3 ubiquitin-protein ligase HECTD3; EC 6.3.2.-; FLJ21156; FLJ31983; HECT domain containing 3; HECT domain-containing protein 3; MGC161630; probable E3 ubiquitin-protein ligase HECTD3; RP11-69J16.1 HECTD3 HECT domain E3 ubiquitin protein ligase 3 E3 ubiquitin-protein ligase HECTD3|HECT domain containing E3 ubiquitin protein ligase 3|HECT-type E3 ubiquitin transferase HECTD3

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on HECTD3, check out the HECTD3 Infographic

HECTD3 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for HECTD3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A11560

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HECTD3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-HECTD3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-HECTD3 Antibody Picoband™


We are currently using anti-HECTD3 antibody A11560 for rat tissue, and we are well pleased with the IHC-F results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-01-16


The anti-HECTD3 antibody (A11560) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-01-16


Our lab want to know about to test anti-HECTD3 antibody A11560 on human erythroleukemia for research purposes, then I may be interested in using anti-HECTD3 antibody A11560 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-08-30


The products we sell, including anti-HECTD3 antibody A11560, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-08-30


I have attached the WB image, lot number and protocol we used for erythroleukemia using anti-HECTD3 antibody A11560. Please let me know if you require anything else.

L. Anderson

Verified customer

Asked: 2015-06-17


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-06-17


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.