Anti-HIF-1-alpha/HIF1A Antibody Picoband™

HIF-1 alpha antibody

Boster Bio Anti-HIF-1-alpha/HIF1A Antibody Picoband™ catalog # PB9253. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 74 publication(s).

Product Info Summary

SKU: PB9253
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-HIF-1-alpha/HIF1A Antibody Picoband™

View all HIF-1 alpha Antibodies

SKU/Catalog Number

PB9253

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HIF-1-alpha/HIF1A Antibody Picoband™ catalog # PB9253. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HIF-1-alpha/HIF1A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9253)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha, different from the related mouse and rat sequences by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9253 is reactive to HIF1A in Human, Mouse, Rat

Applications

PB9253 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

115-120 kDa

Calculated molecular weight

92.67kDa

Background of HIF-1 alpha

HIF-1α (Hypoxia-inducible factor 1α, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1α transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1α regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For HIF1A (Source: Uniprot.org, NCBI)

Gene Name

HIF1A

Full Name

Hypoxia-inducible factor 1-alpha

Weight

92.67kDa

Alternative Names

AINT; HIF-1 alpha; HIF1A; ARNT interacting protein; ARNT-interacting protein; Basic-helix-loop-helix-PAS protein MOP1; BHLHE78; Class E basic helix-loop-helix protein 78; H1alpha67; HIF 1A; HIF1 alpha; HIF-1 alpha; HIF1; HIF1A; HIF-1a; HIF-1alpha; HIF-1-alpha; HIF1-alpha; hypoxia inducible factor 1 alpha subunit, hypoxia inducible factor 1 subunit alpha; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; Member of PAS protein 1; member of PAS superfamily 1; MOP1; PAS domain-containing protein 8; PASD8 HIF1A HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78 hypoxia inducible factor 1 subunit alpha hypoxia-inducible factor 1-alpha|ARNT interacting protein|PAS domain-containing protein 8|basic-helix-loop-helix-PAS protein MOP1|class E basic helix-loop-helix protein 78|hypoxia inducible factor 1 alpha subunit|hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)|hypoxia-inducible factor1alpha|member of PAS protein 1|member of PAS superfamily 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HIF1A, check out the HIF1A Infographic

HIF1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HIF1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9253 has been cited in 74 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

AhR activation attenuates calcium oxalate nephrocalcinosis by diminishing M1 macrophage polarization and promoting M2 macrophage polarization

Expression of hypoxia-inducible factor 1 alpha and oligodendrocyte lineage gene-1 in cultured brain slices after oxygen-glucose deprivation

Hypoxia-inducible factor-1α modulates the down-regulation of the homeodomain protein CDX2 in colorectal cancer

Nitric oxide signaling pathway activation inhibits the immune escape of pancreatic carcinoma cells

Role of hypoxia-inducible factor-1α in pathogenesis and disease evaluation of ulcerative colitis

Oxidative stress and hypoxia-induced factor 1α expression in gastric ischemia

Effect of Negative Pressure on Human Bone Marrow Mesenchymal Stem Cells In Vitro

The Role of Psychologic Stress‐Induced Hypoxia‐Inducible Factor‐1α in Rat Experimental Periodontitis

CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis

Expression of Rac1, HIF-1α, and VEGF in Gastric Carcinoma: Correlation with Angiogenesis and Prognosis

Have you used Anti-HIF-1-alpha/HIF1A Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-HIF-1-alpha/HIF1A Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

18 Customer Q&As for Anti-HIF-1-alpha/HIF1A Antibody Picoband™

Question

Our lab used your anti-HIF-1-alpha/HIF1A antibody for WB on liver last year. I am using rat, and We intend to use the antibody for IHC next. My lab would like examining liver as well as glial tumor in our next experiment. Could give a recommendation on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2020-04-16

Answer

I have checked the website and datasheets of our anti-HIF-1-alpha/HIF1A antibody and I see that PB9253 has been validated on rat in both WB and IHC. Thus PB9253 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-04-16

Question

Please see the WB image, lot number and protocol we used for visceral pleura using anti-HIF-1-alpha/HIF1A antibody PB9253. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-27

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-27

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for visceral pleura using anti-HIF-1-alpha/HIF1A antibody PB9253. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-01-13

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-13

Question

you antibody to test anti-HIF-1-alpha/HIF1A antibody PB9253 on human visceral pleura for research purposes, then I may be interested in using anti-HIF-1-alpha/HIF1A antibody PB9253 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-01-09

Answer

The products we sell, including anti-HIF-1-alpha/HIF1A antibody PB9253, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-09

Question

We want using your anti-HIF-1-alpha/HIF1A antibody for positive regulation of blood vessel endothelial cell migration studies. Has this antibody been tested with western blotting on mouse intestine tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-08-09

Answer

Thank you for your inquiry. This PB9253 anti-HIF-1-alpha/HIF1A antibody is validated on mouse intestine tissue, intestinal cancer tissue, rat intestine tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-08-09

Question

What specific lysis buffer and blocking buffer was used in the PB9253 Antibody protocol?

Verified customer

Asked: 2019-07-15

Answer

The Lysis buffer used in the Anti-HIF-1-alpha/HIF1A Antibody Picoband PB9253 protocol was RIPA lysis buffer. The Blocking buffer was 5% Non-fat Milk/ TBS.

Boster Scientific Support

Answered: 2019-07-15

Question

Do you have a WB testing with cobalt chloride treatment of the cells prior to lysing/testing for PB9253 Antibody?

Verified customer

Asked: 2019-07-10

Answer

Our lab did not perform a WB test on PON1 Paraoxonase-1 Human Recombinant Protein PROTP27169 with cobalt chloride treatment of the cells prior to lysing/testing.

Boster Scientific Support

Answered: 2019-07-10

Question

We have observed staining in human glial tumor. Are there any suggestions? Is anti-HIF-1-alpha/HIF1A antibody supposed to stain glial tumor positively?

Verified Customer

Verified customer

Asked: 2019-06-17

Answer

Based on literature glial tumor does express HIF1A. Based on Uniprot.org, HIF1A is expressed in visceral pleura, hepatoma, glial tumor, liver, choriocarcinoma placenta, among other tissues. Regarding which tissues have HIF1A expression, here are a few articles citing expression in various tissues:
Choriocarcinoma, and Placenta, Pubmed ID: 15489334
Hepatoma, Pubmed ID: 9079689
Liver, Pubmed ID: 12508121

Boster Scientific Support

Answered: 2019-06-17

Question

Is a blocking peptide available for product anti-HIF-1-alpha/HIF1A antibody (PB9253)?

Verified Customer

Verified customer

Asked: 2019-05-13

Answer

We do provide the blocking peptide for product anti-HIF-1-alpha/HIF1A antibody (PB9253). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-05-13

Question

I see that the anti-HIF-1-alpha/HIF1A antibody PB9253 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-06-15

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-06-15

Question

Is this PB9253 anti-HIF-1-alpha/HIF1A antibody reactive to the isotypes of HIF1A?

Verified Customer

Verified customer

Asked: 2018-05-29

Answer

The immunogen of PB9253 anti-HIF-1-alpha/HIF1A antibody is A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-05-29

Question

Will anti-HIF-1-alpha/HIF1A antibody PB9253 work for IHC with visceral pleura?

Verified Customer

Verified customer

Asked: 2018-01-30

Answer

According to the expression profile of visceral pleura, HIF1A is highly expressed in visceral pleura. So, it is likely that anti-HIF-1-alpha/HIF1A antibody PB9253 will work for IHC with visceral pleura.

Boster Scientific Support

Answered: 2018-01-30

Question

Does PB9253 anti-HIF-1-alpha/HIF1A antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-09-13

Answer

You can see on the product datasheet, PB9253 anti-HIF-1-alpha/HIF1A antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-09-13

Question

Is there a BSA free version of anti-HIF-1-alpha/HIF1A antibody PB9253 available?

D. Parker

Verified customer

Asked: 2017-08-11

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-HIF-1-alpha/HIF1A antibody PB9253 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-08-11

Question

We were content with the WB result of your anti-HIF-1-alpha/HIF1A antibody. However we have seen positive staining in glial tumor cytoplasm. using this antibody. Is that expected? Could you tell me where is HIF1A supposed to be expressed?

J. Bhatt

Verified customer

Asked: 2015-04-20

Answer

From what I have seen in literature, glial tumor does express HIF1A. Generally HIF1A expresses in cytoplasm. Regarding which tissues have HIF1A expression, here are a few articles citing expression in various tissues:
Choriocarcinoma, and Placenta, Pubmed ID: 15489334
Hepatoma, Pubmed ID: 9079689
Liver, Pubmed ID: 12508121

Boster Scientific Support

Answered: 2015-04-20

Question

I was wanting to use your anti-HIF-1-alpha/HIF1A antibody for IHC for human visceral pleura on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human visceral pleura identification?

P. Evans

Verified customer

Asked: 2014-01-24

Answer

As indicated on the product datasheet, PB9253 anti-HIF-1-alpha/HIF1A antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human visceral pleura in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-01-24

Question

I have a question about product PB9253, anti-HIF-1-alpha/HIF1A antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

E. Mitchell

Verified customer

Asked: 2013-06-27

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9253 anti-HIF-1-alpha/HIF1A antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-06-27

Question

We are currently using anti-HIF-1-alpha/HIF1A antibody PB9253 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?

C. Thomas

Verified customer

Asked: 2013-01-22

Answer

The anti-HIF-1-alpha/HIF1A antibody (PB9253) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-01-22

Order DetailsPrice
PB9253

100μg

$370
PB9253-10ug

10μg sample (liquid)

$99
PB9253-Biotin

100 μg Biotin conjugated

$570
PB9253-Cy3

100 μg Cy3 conjugated

$570
PB9253-Dylight488

100 μg Dylight488 conjugated

$570
PB9253-Dylight550

100 μg Dylight550 conjugated

$570
PB9253-Dylight594

100 μg Dylight594 conjugated

$570
PB9253-FITC

100 μg FITC conjugated

$570
PB9253-HRP

100 μg HRP conjugated

$570
PB9253-APC

100 μg APC conjugated

$670
PB9253-PE

100 μg PE conjugated

$670
PB9253-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9253
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.