Anti-HSD11B2 Antibody

Boster Bio Anti-HSD11B2 Antibody catalog # RP1094. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: RP1094
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-HSD11B2 Antibody

See all HSD11B2 products

SKU/Catalog Number

RP1094

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HSD11B2 Antibody catalog # RP1094. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HSD11B2 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1094)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

RP1094 is reactive to HSD11B2 in Human, Mouse, Rat

Applications

RP1094 is guaranteed for WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For HSD11B2 (Source: Uniprot.Org, NCBI)

Uniprot ID

P80365

Gene ID

3291

Gene Name

HSD11B2

Full Name

Corticosteroid 11-beta-dehydrogenase isozyme 2

Weight

44.127kDa

Superfamily

short-chain dehydrogenases/reductases (SDR) family

Alternative Names

11 betaHSD2; 11 beta-HSD2; AME; corticosteroid 11-beta-dehydrogenase isozyme 2,11-beta-HSD2; EC 1.1.1; EC 1.1.1.-; HSD11B2; HSD11KAME1; HSD2,11-DH2; hydroxysteroid (11-beta) dehydrogenase 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; SDR9C3; short chain dehydrogenase/reductase family 9C member 3,11-beta-hydroxysteroid dehydrogenase type 2 HSD11B2 AME, AME1, HSD11K, HSD2, SDR9C3 hydroxysteroid 11-beta dehydrogenase 2 corticosteroid 11-beta-dehydrogenase isozyme 2|-HSD11 type II|11-DH2|11-HSD type II|11-beta-HSD type II|11-beta-HSD2|11-beta-hydroxysteroid dehydrogenase type 2|11-beta-hydroxysteroid dehydrogenase type II|NAD-dependent 11-beta-hydroxysteroid dehydrogenase|short chain dehydrogenase/reductase family 9C member 3

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on HSD11B2, check out the HSD11B2 Infographic

HSD11B2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for HSD11B2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for RP1094

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HSD11B2 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-HSD11B2 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-HSD11B2 Antibody

Question

I see that the anti-HSD11B2 antibody RP1094 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-04-20

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-04-20

Question

My question regards to test anti-HSD11B2 antibody RP1094 on mouse placenta for research purposes, then I may be interested in using anti-HSD11B2 antibody RP1094 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-31

Answer

The products we sell, including anti-HSD11B2 antibody RP1094, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-31

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-HSD11B2 antibody RP1094. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-10-29

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-10-29

Question

We are currently using anti-HSD11B2 antibody RP1094 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?

M. Johnson

Verified customer

Asked: 2013-09-20

Answer

The anti-HSD11B2 antibody (RP1094) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-09-20

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
RP1094
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.