Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7)

Boster Bio Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7) catalog # M00129-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: M00129-1
Size: 100ug/vial
Reactive Species: Human, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7)

See all Isocitrate Dehydrogenase 1/IDH1 products

SKU/Catalog Number

M00129-1

Size

100ug/vial

Form

Liquid

Description

Boster Bio Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7) catalog # M00129-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00129-1)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Monoclonal

Clone Number

16H7

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M00129-1 is reactive to IDH1 in Human, Mouse, Rat

Applications

M00129-1 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For IDH1 (Source: Uniprot.Org, NCBI)

Uniprot ID

O75874

Gene ID

3417

Gene Name

IDH1

Full Name

Isocitrate dehydrogenase [NADP] cytoplasmic

Weight

46.659kDa

Superfamily

isocitrate and isopropylmalate dehydrogenases family

Alternative Names

Cytosolic NADP-isocitrate dehydrogenase; EC 1.1.1.42; IDCD; IDH; IDH1; IDP; IDPC; isocitrate dehydrogenase [NADP] cytoplasmic; isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate Dehydrogenase 1; NADP(+)-specific ICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; Oxalosuccinate decarboxylase; PICD IDH1 HEL-216, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD isocitrate dehydrogenase (NADP(+)) 1 isocitrate dehydrogenase [NADP] cytoplasmic|NADP(+)-specific ICDH|NADP-dependent isocitrate dehydrogenase, cytosolic|NADP-dependent isocitrate dehydrogenase, peroxisomal|epididymis luminal protein 216|epididymis secretory protein Li 26|epididymis secretory sperm binding protein|isocitrate dehydrogenase (NADP(+)) 1, cytosolic|isocitrate dehydrogenase 1 (NADP+), soluble|oxalosuccinate decarboxylase

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on IDH1, check out the IDH1 Infographic

IDH1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for IDH1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M00129-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-IDH1 Antibody Picoband™ (monoclonal, 16H7)

Question

My team were happy with the WB result of your anti-IDH1 antibody (monoclonal, 16H7). However we have been able to see positive staining in lung placenta cytoplasm using this antibody. Is that expected? Could you tell me where is IDH1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-06

Answer

According to literature, lung placenta does express IDH1. Generally IDH1 expresses in cytoplasm, cytosol. Regarding which tissues have IDH1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 19608861
Endometrium, Pubmed ID: 17974005
Kidney, Pubmed ID: 11230166
Liver, Pubmed ID: 24275569
Lung, and Placenta, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-12-06

Question

We are interested in using your anti-IDH1 antibody (monoclonal, 16H7) for glyoxylate cycle studies. Has this antibody been tested with western blotting on a431 cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-12-19

Answer

Thank you for your inquiry. This M00129-1 anti-IDH1 antibody (monoclonal, 16H7) is validated on a431 cell lysate. It is guaranteed to work for Flow Cytometry, IF, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-12-19

Question

We purchased anti-IDH1 antibody (monoclonal, 16H7) for WB on brain a few years ago. I am using human, and We intend to use the antibody for Flow Cytometry next. I would like examining brain as well as cajal-retzius cell fetal brain cortex in our next experiment. Could you please give me some suggestion on which antibody would work the best for Flow Cytometry?

Verified Customer

Verified customer

Asked: 2018-10-05

Answer

I have checked the website and datasheets of our anti-IDH1 antibody (monoclonal, 16H7) and I see that M00129-1 has been validated on human in both WB and Flow Cytometry. Thus M00129-1 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-10-05

Question

We are currently using anti-IDH1 antibody (monoclonal, 16H7) M00129-1 for mouse tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

R. Carter

Verified customer

Asked: 2018-01-22

Answer

The anti-IDH1 antibody (monoclonal, 16H7) (M00129-1) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-22

Question

We have been able to see staining in mouse metanephros. Any tips? Is anti-IDH1 antibody (monoclonal, 16H7) supposed to stain metanephros positively?

K. Bhatt

Verified customer

Asked: 2016-02-16

Answer

According to literature metanephros does express IDH1. According to Uniprot.org, IDH1 is expressed in metanephros, kidney, endometrium, lung placenta, brain, cajal-retzius cell fetal brain cortex, liver, among other tissues. Regarding which tissues have IDH1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 19608861
Endometrium, Pubmed ID: 17974005
Kidney, Pubmed ID: 11230166
Liver, Pubmed ID: 24275569
Lung, and Placenta, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2016-02-16

$240

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
M00129-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.