Anti-IFNGR1 Antibody Picoband™

Boster Bio Anti-IFNGR1 Antibody Picoband™ catalog # A01716-2. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A01716-2
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-IFNGR1 Antibody Picoband™

See all IFN-gamma R1/CD119 products

SKU/Catalog Number

A01716-2

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-IFNGR1 Antibody Picoband™ catalog # A01716-2. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IFNGR1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01716-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH), different from the related mouse sequence by eighteen amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01716-2 is reactive to IFNGR1 in Human

Applications

A01716-2 is guaranteed for Flow Cytometry, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For IFNGR1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P15260

Gene ID

3459

Gene Name

IFNGR1

Full Name

Interferon gamma receptor 1

Weight

54.405kDa

Superfamily

type II cytokine receptor family

Alternative Names

AVP, type 2; CD119 antigen; CD119; FLJ45734; IFN-gamma R1; IFN-gamma receptor 1; IFNgammaR1; IFN-gamma-R1; IFNGR; IFNGR1; IFN-gR1; immune interferon receptor 1; interferon gamma receptor 1; interferon-gamma receptor alpha chain; type 2 IFNGR1 CD119, IFNGR, IMD27A, IMD27B interferon gamma receptor 1 interferon gamma receptor 1|AVP, type 2|CD119 antigen|CDw119|IFN-gamma receptor 1|IFN-gamma-R-alpha|IFN-gamma-R1|antiviral protein, type 2|immune interferon receptor 1|interferon-gamma receptor alpha chain

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on IFNGR1, check out the IFNGR1 Infographic

IFNGR1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for IFNGR1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A01716-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-IFNGR1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-IFNGR1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-IFNGR1 Antibody Picoband™

Question

I was wanting to use your anti-IFNGR1 antibody for Flow Cytometry for human erythroleukemia on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human erythroleukemia identification?

Verified Customer

Verified customer

Asked: 2019-11-25

Answer

As indicated on the product datasheet, A01716-2 anti-IFNGR1 antibody has been validated for Flow Cytometry, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human erythroleukemia in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-11-25

Question

We are currently using anti-IFNGR1 antibody A01716-2 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2018-04-02

Answer

The anti-IFNGR1 antibody (A01716-2) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-04-02

Question

My question regarding product A01716-2, anti-IFNGR1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-03-02

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01716-2 anti-IFNGR1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-03-02

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A01716-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.