Overview
Product Name |
Anti-IKK gamma/IKBKG Antibody Picoband™
See more IKBKG products |
Catalog# |
A00874 |
Pack Size |
100ug/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-IKK gamma/IKBKG Antibody Picoband™ catalog # A00874. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100ug/vial in Lyophilized form antibody. |
Cite This Product |
Anti-IKK gamma/IKBKG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00874)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-IKK gamma/IKBKG Antibody Picoband™ may replace the following items: sc 53027|sc 25609|sc 1778|sc 9354|sc 19609|sc 52219|sc 69947|sc 69946|sc 15844|sc 15843|sc 15840|sc 8256|sc 8330|sc 166700|sc 166397|sc 166398|sc 8032|sc 56919|sc 52930|sc 71331|sc 8256 R. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human, Mouse, Rat |
Applications |
Flow Cytometry, IF, ICC, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids. |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For IKBKG (Source: Uniprot.org, NCBI)
Uniprot Id | Q9Y6K9 |
---|
NCBI Gene Id | 8517 |
---|
Species Of This Entry | Human |
---|
Gene Name | IKBKG |
---|
Protein Name | NF-kappa-B essential modulator |
---|
Alternative Names | IKBKG|FIP-3IP2; FIP3NF-kappa-B essential modifier; FIP3P; I-kappa-B kinase subunit gamma; IkB kinase gamma subunit; IkB kinase subunit gamma; IkB kinase-associated protein 1; IKBKG; IKK gamma; IKKAP1; IKKG; IKK-gammaIPD2; incontinentia pigmenti; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma; Inhibitor of nuclear factor kappa-B kinase subunit gamma; IP; IP1; NEMO; NEMOAMCBX1; NFkappaB essential modulator; NF-kappa-B essential modulator |
---|
Molecular Weight | 48198 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on IKBKG, check out the IKBKG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for IKBKG: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the IKBKG infographic
Our Boster Quality Guarantee for Anti-IKK gamma/IKBKG Antibody Picoband™ covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Flow Cytometry, 1-3μg/1x10
6 cells, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of IKK gamma using anti-IKK gamma antibody (A00874).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
lane 1: rat cardiac muscle tissue lysates,
lane 2: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IKK gamma antigen affinity purified polyclonal antibody (Catalog # A00874) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IKK gamma at approximately 48KD. The expected band size for IKK gamma is at 48KD.
Figure 2. Flow Cytometry analysis of U87 cells using anti-IKK gamma antibody (A00874).
Overlay histogram showing U87 cells stained with A00874 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IKK gamma Antibody (A00874,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Figure 3. Flow Cytometry analysis of PC-3 cells using anti-IKK gamma antibody (A00874).
Overlay histogram showing PC-3 cells stained with A00874 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IKK gamma Antibody (A00874,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Figure 4. IF analysis of IKK gamma using anti-IKK gamma antibody (A00874).
IKK gamma was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-IKK gamma Antibody (A00874) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A00874 Anti-IKK gamma/IKBKG Antibody Picoband™
0 Related Questions