Anti-IKK gamma/IKBKG Antibody Picoband™

Product Name

Anti-IKK gamma/IKBKG Antibody Picoband™

See all IKBKG products

SKU/Catalog Number

A00874

Size

100ug/vial

Form

Lyophilized

Description

Boster Bio Anti-IKK gamma/IKBKG Antibody Picoband™ catalog # A00874. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IKK gamma/IKBKG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00874)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00874 is reactive to IKBKG in Human, Mouse, Rat

Applications

A00874 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Flow Cytometry, 1-3μg/1x10⁶ cells, Human

Validation Images & Assay Conditions

Click image to see more details

Figure 1. Western blot analysis of IKK gamma using anti-IKK gamma antibody (A00874).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
lane 1: rat cardiac muscle tissue lysates,
lane 2: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IKK gamma antigen affinity purified polyclonal antibody (Catalog # A00874) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IKK gamma at approximately 48KD. The expected band size for IKK gamma is at 48KD.

Click image to see more details

Figure 2. Flow Cytometry analysis of U87 cells using anti-IKK gamma antibody (A00874).
Overlay histogram showing U87 cells stained with A00874 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IKK gamma Antibody (A00874,1μg/1x10⁶ cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x10⁶ cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10⁶) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

Click image to see more details

Figure 3. Flow Cytometry analysis of PC-3 cells using anti-IKK gamma antibody (A00874).
Overlay histogram showing PC-3 cells stained with A00874 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IKK gamma Antibody (A00874,1μg/1x10⁶ cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x10⁶ cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10⁶) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

Click image to see more details

Figure 4. IF analysis of IKK gamma using anti-IKK gamma antibody (A00874).
IKK gamma was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-IKK gamma Antibody (A00874) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

Gene/Protein Information For IKBKG (Source: Uniprot.Org, NCBI)

Alternative Names

FIP-3IP2; FIP3NF-kappa-B essential modifier; FIP3P; I-kappa-B kinase subunit gamma; IkB kinase gamma subunit; IkB kinase subunit gamma; IkB kinase-associated protein 1; IKBKG; IKK gamma; IKKAP1; IKKG; IKK-gammaIPD2; incontinentia pigmenti; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma; Inhibitor of nuclear factor kappa-B kinase subunit gamma; IP; IP1; NEMO; NEMOAMCBX1; NFkappaB essential modulator; NF-kappa-B essential modulator IKBKG AMCBX1, EDAID1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9 inhibitor of nuclear factor kappa B kinase regulatory subunit gamma NF-kappa-B essential modulator|I-kappa-B kinase subunit gamma|NF-kappa-B essential modifier|ikB kinase subunit gamma|ikB kinase-associated protein 1|incontinentia pigmenti|inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma|inhibitor of nuclear factor kappa B kinase subunit gamma

For more info on IKBKG, check out the IKBKG Infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for IKBKG: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

Take me to the IKBKG Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis