Anti-IKK gamma/IKBKG Antibody Picoband™

Boster Bio Anti-IKK gamma/IKBKG Antibody Picoband™ catalog # A00874. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00874
Size: 100ug/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-IKK gamma/IKBKG Antibody Picoband™

See all IKBKG products

SKU/Catalog Number

A00874

Size

100ug/vial

Form

Lyophilized

Description

Boster Bio Anti-IKK gamma/IKBKG Antibody Picoband™ catalog # A00874. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IKK gamma/IKBKG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00874)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human IKK gamma (207-246aa QSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIK), different from the related mouse and rat sequences by three amino acids.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00874 is reactive to IKBKG in Human, Mouse, Rat

Applications

A00874 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For IKBKG (Source: Uniprot.Org, NCBI)

Uniprot ID

Q9Y6K9

Gene ID

8517

Gene Name

IKBKG

Full Name

NF-kappa-B essential modulator

Weight

48.198kDa

Alternative Names

FIP-3IP2; FIP3NF-kappa-B essential modifier; FIP3P; I-kappa-B kinase subunit gamma; IkB kinase gamma subunit; IkB kinase subunit gamma; IkB kinase-associated protein 1; IKBKG; IKK gamma; IKKAP1; IKKG; IKK-gammaIPD2; incontinentia pigmenti; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma; Inhibitor of nuclear factor kappa-B kinase subunit gamma; IP; IP1; NEMO; NEMOAMCBX1; NFkappaB essential modulator; NF-kappa-B essential modulator IKBKG AMCBX1, EDAID1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9 inhibitor of nuclear factor kappa B kinase regulatory subunit gamma NF-kappa-B essential modulator|I-kappa-B kinase subunit gamma|NF-kappa-B essential modifier|ikB kinase subunit gamma|ikB kinase-associated protein 1|incontinentia pigmenti|inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma|inhibitor of nuclear factor kappa B kinase subunit gamma

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on IKBKG, check out the IKBKG Infographic

IKBKG infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for IKBKG: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00874

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-IKK gamma/IKBKG Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-IKK gamma/IKBKG Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-IKK gamma/IKBKG Antibody Picoband™

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00874
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.