Anti-liver FABP/FABP1 Antibody Picoband™

Boster Bio Anti-liver FABP/FABP1 Antibody Picoband™ catalog # PB9586. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: PB9586
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-liver FABP/FABP1 Antibody Picoband™

See all FABP1/L-FABP products

SKU/Catalog Number

PB9586

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-liver FABP/FABP1 Antibody Picoband™ catalog # PB9586. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-liver FABP/FABP1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9586)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9586 is reactive to FABP1 in Human, Mouse, Rat

Applications

PB9586 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For FABP1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P07148

Gene ID

2168

Gene Name

FABP1

Full Name

Fatty acid-binding protein, liver

Weight

14.208kDa

Superfamily

calycin superfamily

Alternative Names

FABP1; FABPL; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; LFABP; L-FABP; L-FABPFatty acid-binding protein 1; Liver-type fatty acid-binding protein FABP1 FABPL, L-FABP fatty acid binding protein 1 fatty acid-binding protein, liver|fatty acid binding protein 1, liver|liver-type fatty acid-binding protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on FABP1, check out the FABP1 Infographic

FABP1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for FABP1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB9586 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Huang Y,Zhao C,Kong Y,Tan P,Liu S,Liu Y,Zeng F,Yuan Y,Zhao B,Wang J.Elucidation of the mechanism of NEFA-induced PERK-eIF2α signaling pathway regulation of lipid metabolism in bovine hepatocytes.J Steroid Biochem Mol Biol.2021 Apr 2:105893.doi:10.101 6/j.jsbmb.2021.105893.Epub ahead of print.PMID:33819629.
Species: Holstein calves
PB9586 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:1:1000

Kong Y, Zhao C, Huang Y, Liu Y, Liu S, Guo Y, Li M, Xu T, Zhao B, Wang J. Angiopoietin-like protein 4 promotes very-low-density lipoprotein assembly and secretion in bovine hepatocytes in vitro. IUBMB Life. 2020 Nov 17. doi: 10.1002/iub.2403. Epub ahead o
Species: Calf
PB9586 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:NA

Have you used Anti-liver FABP/FABP1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-liver FABP/FABP1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-liver FABP/FABP1 Antibody Picoband™

Question

Is this PB9586 anti-liver FABP/FABP1 antibody reactive to the isotypes of FABP1?

Verified Customer

Verified customer

Asked: 2020-02-07

Answer

The immunogen of PB9586 anti-liver FABP/FABP1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-07

Question

Is a blocking peptide available for product anti-liver FABP/FABP1 antibody (PB9586)?

Verified Customer

Verified customer

Asked: 2019-12-27

Answer

We do provide the blocking peptide for product anti-liver FABP/FABP1 antibody (PB9586). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-27

Question

Will anti-liver FABP/FABP1 antibody PB9586 work for IHC with colon?

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

According to the expression profile of colon, FABP1 is highly expressed in colon. So, it is likely that anti-liver FABP/FABP1 antibody PB9586 will work for IHC with colon.

Boster Scientific Support

Answered: 2019-08-13

Question

We are currently using anti-liver FABP/FABP1 antibody PB9586 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

A. Baker

Verified customer

Asked: 2019-07-25

Answer

The anti-liver FABP/FABP1 antibody (PB9586) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-25

Question

Does PB9586 anti-liver FABP/FABP1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

F. Miller

Verified customer

Asked: 2019-07-24

Answer

As indicated on the product datasheet, PB9586 anti-liver FABP/FABP1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-07-24

Question

Can you help my question with product PB9586, anti-liver FABP/FABP1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-08-01

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9586 anti-liver FABP/FABP1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-08-01

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon using anti-liver FABP/FABP1 antibody PB9586. Let me know if you need anything else.

A. Thomas

Verified customer

Asked: 2017-04-14

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-04-14

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9586
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.