Anti-MCUR1 Antibody Picoband™

Boster Bio Anti-MCUR1 Antibody Picoband™ catalog # A08547-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A08547-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC-P, WB

Product Name

Anti-MCUR1 Antibody Picoband™

See all MCUR1 products

SKU/Catalog Number







Boster Bio Anti-MCUR1 Antibody Picoband™ catalog # A08547-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MCUR1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A08547-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A08547-1 is reactive to MCUR1 in Human, Mouse, Rat


A08547-1 is guaranteed for IHC-P, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For MCUR1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Mitochondrial calcium uniporter regulator 1




CCDC90 family

Alternative Names

Mitochondrial calcium uniporter regulator 1 MCUR1 C6orf79, CCDC90A, FMP32 mitochondrial calcium uniporter regulator 1 mitochondrial calcium uniporter regulator 1|MCU regulator 1|coiled-coil domain containing 90A|coiled-coil domain-containing protein 90A, mitochondrial|epididymis secretory sperm binding protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on MCUR1, check out the MCUR1 Infographic

MCUR1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for MCUR1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A08547-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-MCUR1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MCUR1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-MCUR1 Antibody Picoband™


We are currently using anti-MCUR1 antibody A08547-1 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-20


The anti-MCUR1 antibody (A08547-1) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-20


Will anti-MCUR1 antibody A08547-1 work for IHC-P with lung ovary?

N. Johnson

Verified customer

Asked: 2019-09-16


According to the expression profile of lung ovary, MCUR1 is highly expressed in lung ovary. So, it is likely that anti-MCUR1 antibody A08547-1 will work for IHC-P with lung ovary.

Boster Scientific Support

Answered: 2019-09-16


Would anti-MCUR1 antibody A08547-1 work on feline WB with adipose tissue?

Verified Customer

Verified customer

Asked: 2019-08-29


Our lab technicians have not tested anti-MCUR1 antibody A08547-1 on feline. You can run a BLAST between feline and the immunogen sequence of anti-MCUR1 antibody A08547-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline adipose tissue in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-29


Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung ovary using anti-MCUR1 antibody A08547-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-04-25


I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-25


See attached the WB image, lot number and protocol we used for lung ovary using anti-MCUR1 antibody A08547-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-09-03


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-09-03


I was wanting to use your anti-MCUR1 antibody for IHC-P for human lung ovary on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lung ovary identification?

C. Mangal

Verified customer

Asked: 2014-11-13


You can see on the product datasheet, A08547-1 anti-MCUR1 antibody has been tested for IHC-P, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human lung ovary in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-11-13


We want to test anti-MCUR1 antibody A08547-1 on human lung ovary for research purposes, then I may be interested in using anti-MCUR1 antibody A08547-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

J. Carter

Verified customer

Asked: 2013-12-12


The products we sell, including anti-MCUR1 antibody A08547-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2013-12-12


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.