Anti-Macrophage metalloelastase MMP12 Antibody

MMP-12 antibody

Boster Bio Anti-Macrophage metalloelastase MMP12 Antibody catalog # RP1089. Tested in ELISA, WB applications. This antibody reacts with Mouse. Cited in 1 publication(s).

Product Info Summary

SKU: RP1089
Size: 100 μg/vial
Reactive Species: Mouse
Host: Rabbit
Application: ELISA, WB

Customers Who Bought This Also Bought

Product Name

Anti-Macrophage metalloelastase MMP12 Antibody

View all MMP-12 Antibodies

SKU/Catalog Number

RP1089

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Macrophage metalloelastase MMP12 Antibody catalog # RP1089. Tested in ELISA, WB applications. This antibody reacts with Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Macrophage metalloelastase MMP12 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1089)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

RP1089 is reactive to Mmp12 in Mouse

Applications

RP1089 is guaranteed for ELISA, WB Boster Guarantee

Background of MMP-12

Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, -
ELISA , 0.1-0.5μg/ml, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For Mmp12 (Source: Uniprot.org, NCBI)

Uniprot ID

P34960

Gene ID

17381

Gene Name

Mmp12

Full Name

Macrophage metalloelastase

Weight

54.971kDa

Superfamily

peptidase M10A family

Alternative Names

EC 3.4.24; hME; HMEEC 3.4.24.65; Macrophage elastase; macrophage metalloelastase; matrix metallopeptidase 12 (macrophage elastase); matrix metalloproteinase 12 (macrophage elastase); Matrix metalloproteinase-12; ME; MGC138506; MME; MMP12; MMP-12 Mmp12|AV378681, MME, MMP1, Mmel|matrix metallopeptidase 12|macrophage metalloelastase|macrophage elastase|matrix metalloproteinase 12

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Mmp12, check out the Mmp12 Infographic

Mmp12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Mmp12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

RP1089 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Vaz M, Rajasekaran S, Potteti Hr, Reddy Sp. Am J Respir Cell Mol Biol. 2015 Jul;53(1):125-34. Doi: 10.1165/Rcmb.2014-0118Oc. Myeloid-Specific Fos-Related Antigen-1 Regulates Cigarette Smoke-Induced Lung Inflammation, Not Emphysema, In Mice.

Have you used Anti-Macrophage metalloelastase MMP12 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Macrophage metalloelastase MMP12 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-Macrophage metalloelastase MMP12 Antibody

Question

We are currently using anti-MMP12 antibody RP1089 for mouse tissue, and we are satisfied with the ELISA results. The species of reactivity given in the datasheet says mouse. Is it likely that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-06

Answer

The anti-MMP12 antibody (RP1089) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-06

Question

We bought anti-MMP12 antibody for ELISA on amniotic fluid in a previous experiment. I am using mouse, and We are going to use the antibody for WB next. you antibody examining amniotic fluid as well as alveolar macrophage in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

R. Baker

Verified customer

Asked: 2019-11-29

Answer

I looked at the website and datasheets of our anti-MMP12 antibody and it seems that RP1089 has been validated on mouse in both ELISA and WB. Thus RP1089 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-11-29

Question

I am looking for using your anti-MMP12 antibody for negative regulation of endothelial cell-matrix adhesion via fibronectin studies. Has this antibody been tested with western blotting on hepa whole cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-12-11

Answer

I appreciate your inquiry. This RP1089 anti-MMP12 antibody is tested on hepa whole cell lysate. It is guaranteed to work for ELISA, WB in mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-12-11

Question

We have observed staining in mouse alveolar macrophage. Are there any suggestions? Is anti-MMP12 antibody supposed to stain alveolar macrophage positively?

B. Gonzalez

Verified customer

Asked: 2016-09-28

Answer

From literature alveolar macrophage does express MMP12. From Uniprot.org, MMP12 is expressed in amniotic fluid, alveolar macrophage, esophagus, among other tissues. Regarding which tissues have MMP12 expression, here are a few articles citing expression in various tissues:
Alveolar macrophage, Pubmed ID: 8226919
Esophagus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2016-09-28

Question

Our team were well pleased with the WB result of your anti-MMP12 antibody. However we have observed positive staining in amniotic fluid extracellular space using this antibody. Is that expected? Could you tell me where is MMP12 supposed to be expressed?

E. Thomas

Verified customer

Asked: 2013-10-10

Answer

According to literature, amniotic fluid does express MMP12. Generally MMP12 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP12 expression, here are a few articles citing expression in various tissues:
Alveolar macrophage, Pubmed ID: 8226919
Esophagus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2013-10-10

Size

Conjugation

Total: $315

SKU:RP1089

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
RP1089
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.