Anti-MMP9 Antibody Picoband®

MMP9 antibody

Boster Bio Anti-MMP9 Antibody Picoband® catalog # PB9668. Tested in ELISA, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 61 publication(s).

Product Info Summary

SKU: PB9668
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: ELISA, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-MMP9 Antibody Picoband®

View all MMP9 Antibodies

SKU/Catalog Number

PB9668
PB0709 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MMP9 Antibody Picoband® catalog # PB9668. Tested in ELISA, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MMP9 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9668)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9, different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9668 is reactive to MMP9 in Human

Observed Molecular Weight

79 kDa

Calculated molecular weight

78.5 kDa

Background of MMP9

Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9668 is guaranteed for ELISA, IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman
Immunohistochemistry(Paraffin-embedded Section)2-5 μg/mlHuman
ELISA0.1-0.5μg/ml-,

Tested application

MMP9 antibody was positively detected by WB in:
human A549 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
MMP9 antibody was positively detected by IHC in:
human liver cancer tissue, human liver cancer tissue, human lymphadenoma tissue, human lymph nodes of gastric adenocarcinoma rectal cancer tissue, human colonic adenocarcinoma tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-MMP9 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-MMP9 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-MMP9 Antibody Picoband®

Question

Do you have a BSA free version of anti-MMP9 antibody PB9668 available?

Verified Customer

Verified customer

Asked: 2020-03-06

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-MMP9 antibody PB9668 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-06

Question

We have observed staining in human umbilical cord blood. Any tips? Is anti-MMP9 antibody supposed to stain umbilical cord blood positively?

Verified Customer

Verified customer

Asked: 2019-12-06

Answer

Based on literature umbilical cord blood does express MMP9. Based on Uniprot.org, MMP9 is expressed in tibia, umbilical cord blood, b-cell, neutrophil, fibrosarcoma, blood, monocytic leukemia, among other tissues. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-12-06

Question

My boss were well pleased with the WB result of your anti-MMP9 antibody. However we have been able to see positive staining in umbilical cord blood extracellular using this antibody. Is that expected? Could you tell me where is MMP9 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-06

Answer

From what I have seen in literature, umbilical cord blood does express MMP9. Generally MMP9 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-12-06

Question

We bought anti-MMP9 antibody for WB on tibia a few months ago. I am using human, and We are going to use the antibody for ELISA next. I was wanting to use examining tibia as well as monocytic leukemia in our next experiment. Could give a recommendation on which antibody would work the best for ELISA?

Verified Customer

Verified customer

Asked: 2019-11-25

Answer

I have checked the website and datasheets of our anti-MMP9 antibody and it seems that PB9668 has been tested on human in both WB and ELISA. Thus PB9668 should work for your application. Our Boster satisfaction guarantee will cover this product for ELISA in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for ELISA detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-11-25

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for blood using anti-MMP9 antibody PB9668. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-08

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-08

Question

Please see the WB image, lot number and protocol we used for blood using anti-MMP9 antibody PB9668. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-10-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-28

Question

Is this PB9668 anti-MMP9 antibody reactive to the isotypes of MMP9?

Verified Customer

Verified customer

Asked: 2019-08-23

Answer

The immunogen of PB9668 anti-MMP9 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-23

Question

We are interested in to test anti-MMP9 antibody PB9668 on human blood for research purposes, then I may be interested in using anti-MMP9 antibody PB9668 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-25

Answer

The products we sell, including anti-MMP9 antibody PB9668, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-25

Question

I was wanting to use your anti-MMP9 antibody for WB for human blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human blood identification?

Verified Customer

Verified customer

Asked: 2019-07-09

Answer

As indicated on the product datasheet, PB9668 anti-MMP9 antibody has been validated for ELISA, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human blood in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-07-09

Question

Is a blocking peptide available for product anti-MMP9 antibody (PB9668)?

Verified Customer

Verified customer

Asked: 2019-07-02

Answer

We do provide the blocking peptide for product anti-MMP9 antibody (PB9668). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-07-02

Question

Would PB9668 anti-MMP9 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-04-25

Answer

It shows on the product datasheet, PB9668 anti-MMP9 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-04-25

Question

We are currently using anti-MMP9 antibody PB9668 for human tissue, and we are satisfied with the ELISA results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?

R. Edwards

Verified customer

Asked: 2019-03-06

Answer

The anti-MMP9 antibody (PB9668) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-03-06

Question

My question regarding product PB9668, anti-MMP9 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-09-06

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9668 anti-MMP9 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-09-06

Question

My question regards using your anti-MMP9 antibody for positive regulation of release of cytochrome c from mitochondria studies. Has this antibody been tested with western blotting on sw620 whole cell lysate? We would like to see some validation images before ordering.

M. Lewis

Verified customer

Asked: 2017-08-02

Answer

I appreciate your inquiry. This PB9668 anti-MMP9 antibody is validated on sw620 whole cell lysate. It is guaranteed to work for ELISA, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-08-02

Question

Will anti-MMP9 antibody PB9668 work for WB with blood?

C. Williams

Verified customer

Asked: 2016-08-15

Answer

According to the expression profile of blood, MMP9 is highly expressed in blood. So, it is likely that anti-MMP9 antibody PB9668 will work for WB with blood.

Boster Scientific Support

Answered: 2016-08-15

Question

I see that the anti-MMP9 antibody PB9668 works with WB, what is the protocol used to produce the result images on the product page?

E. Miller

Verified customer

Asked: 2014-07-17

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2014-07-17

Order DetailsPrice
PB9668

100μg

$370
PB9668-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9668-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9668-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9668-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9668-APC

100 μg APC conjugated (liquid)

$820
PB9668-FITC

100 μg FITC conjugated (liquid)

$570
PB9668-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9668-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9668-HRP

100 μg HRP conjugated (liquid)

$570
PB9668-PE

100 μg PE conjugated (liquid)

$820
PB9668-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9668
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 16, 2026