Anti-MMP3 Antibody Picoband®

MMP3 antibody

Boster Bio Anti-MMP3 Antibody Picoband® catalog # PB9267. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 5 publication(s).

Product Info Summary

SKU: PB9267
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-MMP3 Antibody Picoband®

View all MMP3 Antibodies

SKU/Catalog Number

PB9267
PB0265 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

MMP3 (stromelysin-1) is a secreted matrix metalloproteinase that participates in extracellular matrix (ECM) remodeling and can be activated after release into the ECM (e.g., via plasmin cascade), supporting processes such as tissue repair, inflammation, and invasion biology (putative in disease-specific contexts). Assay context: Human-reactive antibody validated for Western blot; useful when tracking protease-associated ECM turnover signatures alongside basement-membrane markers such as LAMA1/Laminin and growth-factor carrier proteins such as IGFBP3 (IGFBP3 in the IGF transport complex is subject to proteolysis by matrix proteases in related pathways).

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MMP3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9267)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3, different from the related mouse sequence by seven amino acids, and from the related rat sequence by ten amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9267 is reactive to MMP3 in Human

Observed Molecular Weight

22-24 kDa

Calculated molecular weight

54.0 kDa

Background of MMP3

Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9267 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Positive Control

WB: Human Placenta Tissue, U20S Whole Cell, HELA Whole Cell, PANC Whole Cell, COLO320 Whole Cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-MMP3 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-MMP3 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-MMP3 Antibody Picoband®

Question

Does PB9267 anti-MMP3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-03-30

Answer

As indicated on the product datasheet, PB9267 anti-MMP3 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-03-30

Question

I see that the anti-MMP3 antibody PB9267 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2020-03-12

Question

We were happy with the WB result of your anti-MMP3 antibody. However we have been able to see positive staining in lung secreted using this antibody. Is that expected? Could you tell me where is MMP3 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-02-11

Answer

Based on literature, lung does express MMP3. Generally MMP3 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP3 expression, here are a few articles citing expression in various tissues:
Fibroblast, Pubmed ID: 3030290
Lung, Pubmed ID: 15489334
Synovium, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-02-11

Question

We are currently using anti-MMP3 antibody PB9267 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-13

Answer

The anti-MMP3 antibody (PB9267) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-13

Question

We are interested in to test anti-MMP3 antibody PB9267 on human layer of synovial tissue for research purposes, then I may be interested in using anti-MMP3 antibody PB9267 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-10-11

Answer

The products we sell, including anti-MMP3 antibody PB9267, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-10-11

Question

I have attached the WB image, lot number and protocol we used for layer of synovial tissue using anti-MMP3 antibody PB9267. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-16

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-16

Question

Is this PB9267 anti-MMP3 antibody reactive to the isotypes of MMP3?

Verified Customer

Verified customer

Asked: 2019-08-02

Answer

The immunogen of PB9267 anti-MMP3 antibody is A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-02

Question

Is there a BSA free version of anti-MMP3 antibody PB9267 available?

Verified Customer

Verified customer

Asked: 2019-03-06

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-MMP3 antibody PB9267 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-03-06

Question

I have a question about product PB9267, anti-MMP3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

A. Bhatt

Verified customer

Asked: 2018-07-13

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9267 anti-MMP3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-07-13

Question

Is a blocking peptide available for product anti-MMP3 antibody (PB9267)?

Verified Customer

Verified customer

Asked: 2017-11-02

Answer

We do provide the blocking peptide for product anti-MMP3 antibody (PB9267). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2017-11-02

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for layer of synovial tissue using anti-MMP3 antibody PB9267. Let me know if you need anything else.

N. Walker

Verified customer

Asked: 2016-08-16

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-08-16

Question

I am looking for using your anti-MMP3 antibody for positive regulation of oxidative stress-induced cell death studies. Has this antibody been tested with western blotting on human placenta tissue? We would like to see some validation images before ordering.

C. Jones

Verified customer

Asked: 2016-01-04

Answer

Thanks for your inquiry. This PB9267 anti-MMP3 antibody is tested on human placenta tissue, tissue lysate, u20s whole cell lysate, hela whole cell lysate, panc whole cell lysate, colo320 whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2016-01-04

Question

I was wanting to use your anti-MMP3 antibody for WB for human layer of synovial tissue on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human layer of synovial tissue identification?

N. Li

Verified customer

Asked: 2015-12-14

Answer

It shows on the product datasheet, PB9267 anti-MMP3 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human layer of synovial tissue in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-12-14

Question

Does anti-MMP3 antibody PB9267 work for WB with layer of synovial tissue?

M. Jackson

Verified customer

Asked: 2014-10-23

Answer

According to the expression profile of layer of synovial tissue, MMP3 is highly expressed in layer of synovial tissue. So, it is likely that anti-MMP3 antibody PB9267 will work for WB with layer of synovial tissue.

Boster Scientific Support

Answered: 2014-10-23

Question

We have seen staining in human synovium. Do you have any suggestions? Is anti-MMP3 antibody supposed to stain synovium positively?

N. Brown

Verified customer

Asked: 2014-10-07

Answer

According to literature synovium does express MMP3. According to Uniprot.org, MMP3 is expressed in layer of synovial tissue, fibroblast, synovium, lung, among other tissues. Regarding which tissues have MMP3 expression, here are a few articles citing expression in various tissues:
Fibroblast, Pubmed ID: 3030290
Lung, Pubmed ID: 15489334
Synovium, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2014-10-07

Order DetailsPrice
PB9267

100μg

$370
PB9267-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9267-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9267-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9267-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9267-APC

100 μg APC conjugated (liquid)

$820
PB9267-FITC

100 μg FITC conjugated (liquid)

$570
PB9267-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9267-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9267-HRP

100 μg HRP conjugated (liquid)

$570
PB9267-PE

100 μg PE conjugated (liquid)

$820
PB9267-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9267
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 5, 2026