Anti-MUC2 Antibody Picoband™

Boster Bio Anti-MUC2 Antibody Picoband™ catalog # A01212. Tested in IF, IHC-P applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01212
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC-P

Product Name

Anti-MUC2 Antibody Picoband™

See all MUC2 products

SKU/Catalog Number

A01212

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MUC2 Antibody Picoband™ catalog # A01212. Tested in IF, IHC-P applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MUC2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01212)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01212 is reactive to MUC2 in Human, Mouse, Rat

Applications

A01212 is guaranteed for IF, IHC-P Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat
Immunofluorescence, 5μg/ml, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For MUC2 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q02817

Gene ID

4583

Gene Name

MUC2

Full Name

Mucin-2

Weight

540.3kDa

Alternative Names

Intestinal mucin-2; MLP; MUC-2; mucin 2, intestinal/tracheal; mucin 2, oligomeric mucus/gel-forming; mucin-2; mucin-like protein; SMUC MUC2 MLP, MUC-2, SMUC mucin 2, oligomeric mucus/gel-forming mucin-2|mucin 2, intestinal/tracheal

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on MUC2, check out the MUC2 Infographic

MUC2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for MUC2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A01212

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-MUC2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MUC2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-MUC2 Antibody Picoband™

Question

We want using your anti-MUC2 antibody for dectin-2 family studies. Has this antibody been tested with western blotting on colon organoid tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-04-10

Answer

I appreciate your inquiry. This A01212 anti-MUC2 antibody is validated on mouse ileum tissue, small intestine tissue, human ileum tissue, rectal cancer tissue, ileum organoid tissue, colon organoid tissue. It is guaranteed to work for IF, IHC in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-04-10

Question

My team were happy with the WB result of your anti-MUC2 antibody. However we have seen positive staining in intestine secreted. note=in the intestine using this antibody. Is that expected? Could you tell me where is MUC2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-08-12

Answer

From literature, intestine does express MUC2. Generally MUC2 expresses in secreted. note=in the intestine, secreted. Regarding which tissues have MUC2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, Pubmed ID: 1400449, 1885763
Intestine, Pubmed ID: 8300571

Boster Scientific Support

Answered: 2019-08-12

Question

We are currently using anti-MUC2 antibody A01212 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-18

Answer

The anti-MUC2 antibody (A01212) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-18

Question

We have seen staining in mouse cervix carcinoma. Are there any suggestions? Is anti-MUC2 antibody supposed to stain cervix carcinoma positively?

W. Parker

Verified customer

Asked: 2017-07-07

Answer

According to literature cervix carcinoma does express MUC2. According to Uniprot.org, MUC2 is expressed in intestine, colon, cervix carcinoma, among other tissues. Regarding which tissues have MUC2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, Pubmed ID: 1400449, 1885763
Intestine, Pubmed ID: 8300571

Boster Scientific Support

Answered: 2017-07-07

Question

Our lab used your anti-MUC2 antibody for IF on intestine in the past. I am using human, and I plan to use the antibody for IHC next. We want examining intestine as well as cervix carcinoma in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?

B. Evans

Verified customer

Asked: 2016-11-08

Answer

I looked at the website and datasheets of our anti-MUC2 antibody and it seems that A01212 has been tested on human in both IF and IHC. Thus A01212 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2016-11-08

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A01212
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.