Anti-MUC2 Antibody Picoband™

MUC2 antibody

Boster Bio Anti-MUC2 Antibody Picoband™ catalog # A01212. Tested in IF, IHC applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: A01212
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC

Customers Who Bought This Also Bought

Product Name

Anti-MUC2 Antibody Picoband™

View all MUC2 Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-MUC2 Antibody Picoband™ catalog # A01212. Tested in IF, IHC applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MUC2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01212)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01212 is reactive to MUC2 in Human, Mouse, Rat


A01212 is guaranteed for IF, IHC Boster Guarantee

Background of MUC2

Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat
Immunofluorescence, 5μg/ml, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For MUC2 (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name




Alternative Names

Intestinal mucin-2; MLP; MUC-2; mucin 2, intestinal/tracheal; mucin 2, oligomeric mucus/gel-forming; mucin-2; mucin-like protein; SMUC MUC2 MLP, MUC-2, SMUC mucin 2, oligomeric mucus/gel-forming mucin-2|mucin 2, intestinal/tracheal

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on MUC2, check out the MUC2 Infographic

MUC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MUC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A01212 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Maternal exposure to sodium ρ-perfluorous nonenoxybenzene sulfonate during pregnancy and lactation disrupts intestinal barrier and may cause obstacles to the nutrient transport and metabolism in F0 and F1 generations of mice

Bifidobacterium breve ATCC15700 pretreatment prevents alcoholic liver disease through modulating gut microbiota in mice exposed to chronic alcohol intake

Subchronic exposure of environmentally relevant concentrations of F-53B in mice resulted in gut barrier dysfunction and colonic inflammation in a sex-independent manner

Have you used Anti-MUC2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MUC2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-MUC2 Antibody Picoband™


We want using your anti-MUC2 antibody for dectin-2 family studies. Has this antibody been tested with western blotting on colon organoid tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-04-10


I appreciate your inquiry. This A01212 anti-MUC2 antibody is validated on mouse ileum tissue, small intestine tissue, human ileum tissue, rectal cancer tissue, ileum organoid tissue, colon organoid tissue. It is guaranteed to work for IF, IHC in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-04-10


My team were happy with the WB result of your anti-MUC2 antibody. However we have seen positive staining in intestine secreted. note=in the intestine using this antibody. Is that expected? Could you tell me where is MUC2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-08-12


From literature, intestine does express MUC2. Generally MUC2 expresses in secreted. note=in the intestine, secreted. Regarding which tissues have MUC2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, Pubmed ID: 1400449, 1885763
Intestine, Pubmed ID: 8300571

Boster Scientific Support

Answered: 2019-08-12


We are currently using anti-MUC2 antibody A01212 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-18


The anti-MUC2 antibody (A01212) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-18


We have seen staining in mouse cervix carcinoma. Are there any suggestions? Is anti-MUC2 antibody supposed to stain cervix carcinoma positively?

W. Parker

Verified customer

Asked: 2017-07-07


According to literature cervix carcinoma does express MUC2. According to, MUC2 is expressed in intestine, colon, cervix carcinoma, among other tissues. Regarding which tissues have MUC2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, Pubmed ID: 1400449, 1885763
Intestine, Pubmed ID: 8300571

Boster Scientific Support

Answered: 2017-07-07


Our lab used your anti-MUC2 antibody for IF on intestine in the past. I am using human, and I plan to use the antibody for IHC next. We want examining intestine as well as cervix carcinoma in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?

B. Evans

Verified customer

Asked: 2016-11-08


I looked at the website and datasheets of our anti-MUC2 antibody and it seems that A01212 has been tested on human in both IF and IHC. Thus A01212 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website to find out more information about them.

Boster Scientific Support

Answered: 2016-11-08



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.