Anti-Myoglobin/MB Antibody Picoband™

Myoglobin antibody

Boster Bio Anti-Myoglobin/MB Antibody Picoband™ catalog # A04058. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A04058
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-Myoglobin/MB Antibody Picoband™

View all Myoglobin Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-Myoglobin/MB Antibody Picoband™ catalog # A04058. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Myoglobin/MB Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04058)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence at the N-terminus of human Myoglobin (3-35aa LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK), different from the related mouse sequence by three amino acids, and from the related rat sequence by six amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A04058 is reactive to MB in Human


A04058 is guaranteed for WB Boster Guarantee

Background of Myoglobin

Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For MB (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name





globin family

Alternative Names

MB; MGC13548; Myoglobin; PVALB MB PVALB myoglobin myoglobin

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on MB, check out the MB Infographic

MB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A04058

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Myoglobin/MB Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Myoglobin/MB Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-Myoglobin/MB Antibody Picoband™


We are currently using anti-Myoglobin/MB antibody A04058 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-27


The anti-Myoglobin/MB antibody (A04058) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-27


I have a question about product A04058, anti-Myoglobin/MB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-01-07


It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04058 anti-Myoglobin/MB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-01-07


Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for heart using anti-Myoglobin/MB antibody A04058. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-26


Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-26


Will A04058 anti-Myoglobin/MB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-11-06


As indicated on the product datasheet, A04058 anti-Myoglobin/MB antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-11-06


Does anti-Myoglobin/MB antibody A04058 work for WB with heart?

Verified Customer

Verified customer

Asked: 2019-07-26


According to the expression profile of heart, MB is highly expressed in heart. So, it is likely that anti-Myoglobin/MB antibody A04058 will work for WB with heart.

Boster Scientific Support

Answered: 2019-07-26


I see that the anti-Myoglobin/MB antibody A04058 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-07-10


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-07-10


Is this A04058 anti-Myoglobin/MB antibody reactive to the isotypes of MB?

Verified Customer

Verified customer

Asked: 2019-06-20


The immunogen of A04058 anti-Myoglobin/MB antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Myoglobin (3-35aa LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK), different from the related mouse sequence by three amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-20


I was wanting to use to test anti-Myoglobin/MB antibody A04058 on human heart for research purposes, then I may be interested in using anti-Myoglobin/MB antibody A04058 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

K. Kulkarni

Verified customer

Asked: 2018-10-09


The products we sell, including anti-Myoglobin/MB antibody A04058, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-10-09


See below the WB image, lot number and protocol we used for heart using anti-Myoglobin/MB antibody A04058. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2017-08-14


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-08-14


Do you have a BSA free version of anti-Myoglobin/MB antibody A04058 available?

J. Walker

Verified customer

Asked: 2014-10-30


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Myoglobin/MB antibody A04058 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-10-30


Is a blocking peptide available for product anti-Myoglobin/MB antibody (A04058)?

C. Anderson

Verified customer

Asked: 2014-05-01


We do provide the blocking peptide for product anti-Myoglobin/MB antibody (A04058). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2014-05-01


I am interested in using your anti-Myoglobin/MB antibody for response to hydrogen peroxide studies. Has this antibody been tested with western blotting on hepg2 whole cell lysate? We would like to see some validation images before ordering.

O. Anderson

Verified customer

Asked: 2014-04-11


Thanks for your inquiry. This A04058 anti-Myoglobin/MB antibody is tested on human hela, hepg2 whole cell lysate, hela whole cell lysate, jurkat whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2014-04-11


We have observed staining in human heart right ventricle. Do you have any suggestions? Is anti-Myoglobin/MB antibody supposed to stain heart right ventricle positively?

B. Wu

Verified customer

Asked: 2014-01-07


From literature heart right ventricle does express MB. From, MB is expressed in heart right ventricle, skeletal muscle, heart, among other tissues. Regarding which tissues have MB expression, here are a few articles citing expression in various tissues:
Heart, Pubmed ID: 7895732
Skeletal muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2014-01-07



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.