Click image to see more details
Product Info Summary
| SKU: | A00661-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-NKG2D/KLRK1 Antibody Picoband®
SKU/Catalog Number
A00661-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-NKG2D/KLRK1 Antibody Picoband® catalog # A00661-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-NKG2D/KLRK1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00661-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NKG2D, which shares 76.7% amino acid (aa) sequence identity with both mouse and rat NKG2D.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00661-1 is reactive to KLRK1 in Mouse, Rat
Observed Molecular Weight
35 kDa
Calculated molecular weight
25.3 kDa
Background of KLRK1
NKG2D is encoded by KLRK1 gene which is located in the NK-gene complex (NKC) situated on and chromosome 12 in humans. Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00661-1 is guaranteed for Flow Cytometry, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Mouse, Rat |
| Flow Cytometry(Fixed) | 1-3 μg/1x106 cells | Mouse |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of NKG2D/KLRK1 using anti-NKG2D/KLRK1 antibody (A00661-1).
Electrophoresis was performed on a 10% SDS-PAGE gel at 80V (Stacking gel) / 120V (Resolving gel) for 2 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat spleen tissue lysates,
Lane 2: mouse EL-4 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NKG2D/KLRK1 antigen affinity purified polyclonal antibody (A00661-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an ECL Plus Western Blotting Substrate (Catalog # AR1196-200) with Tanon 5200 system. A specific band was detected for NKG2D/KLRK1 at approximately 35 kDa. The expected band size for NKG2D/KLRK1 is at 25 kDa.
Click image to see more details
Flow Cytometry analysis of PC-3 cells using anti-NKG2D/KLRK1 antibody (A00661-1).
Overlay histogram showing EL-4 cells stained with A00661-1 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-NKG2D/KLRK1 Antibody (A00661-1, 1 μg/1x106 cells) for 30 min at 20°C. Fluoro488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Specific Publications For Anti-NKG2D/KLRK1 Antibody Picoband® (A00661-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-NKG2D/KLRK1 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-NKG2D/KLRK1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-NKG2D/KLRK1 Antibody Picoband®
Question
Is a blocking peptide available for product anti-NKG2D/KLRK1 antibody (A00661-1)?
Verified Customer
Verified customer
Asked: 2019-11-29
Answer
We do provide the blocking peptide for product anti-NKG2D/KLRK1 antibody (A00661-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2019-11-29
Question
Is this A00661-1 anti-NKG2D/KLRK1 antibody reactive to the isotypes of KLRK1?
Verified Customer
Verified customer
Asked: 2019-05-31
Answer
The immunogen of A00661-1 anti-NKG2D/KLRK1 antibody is A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-05-31
Question
We are currently using anti-NKG2D/KLRK1 antibody A00661-1 for mouse tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2018-11-23
Answer
The anti-NKG2D/KLRK1 antibody (A00661-1) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-11-23
Question
Would A00661-1 anti-NKG2D/KLRK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-03-19
Answer
You can see on the product datasheet, A00661-1 anti-NKG2D/KLRK1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-03-19
Question
I see that the anti-NKG2D/KLRK1 antibody A00661-1 works with WB, what is the protocol used to produce the result images on the product page?
J. Lewis
Verified customer
Asked: 2017-01-12
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2017-01-12
