Anti-PCDH15 Antibody Picoband™

Boster Bio Anti-PCDH15 Antibody Picoband™ catalog # A03591-1. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A03591-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB

Product Name

Anti-PCDH15 Antibody Picoband™

See all Protocadherin-15 products

SKU/Catalog Number







Boster Bio Anti-PCDH15 Antibody Picoband™ catalog # A03591-1. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PCDH15 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03591-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03591-1 is reactive to PCDH15 in Human, Mouse, Rat


A03591-1 is guaranteed for Flow Cytometry, IHC-P, IHC-F, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For PCDH15 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name




Alternative Names

autosomal recessive 23; cadherin-related family member 15; CDHR15; DFNB23; DKFZp667A1711; PCDH15; Protocadherin15; Protocadherin-15; protocadherin-related 15; USH1F PCDH15 CDHR15, DFNB23, USH1F protocadherin related 15 protocadherin-15|cadherin-related family member 15

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PCDH15, check out the PCDH15 Infographic

PCDH15 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PCDH15: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A03591-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-PCDH15 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PCDH15 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-PCDH15 Antibody Picoband™


See attached the WB image, lot number and protocol we used for retina using anti-PCDH15 antibody A03591-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-04-27


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-27


Is there a BSA free version of anti-PCDH15 antibody A03591-1 available?

Verified Customer

Verified customer

Asked: 2019-12-26


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-PCDH15 antibody A03591-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-26


Will anti-PCDH15 antibody A03591-1 work on monkey IHC-P with corpus callosum?

Verified Customer

Verified customer

Asked: 2019-08-30


Our lab technicians have not tested anti-PCDH15 antibody A03591-1 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-PCDH15 antibody A03591-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey corpus callosum in IHC-P, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-30


Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for retina using anti-PCDH15 antibody A03591-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-03-11


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-03-11


I have a question about product A03591-1, anti-PCDH15 antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-10-16


It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03591-1 anti-PCDH15 antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-10-16


Will anti-PCDH15 antibody A03591-1 work for IHC-F with retina?

Verified Customer

Verified customer

Asked: 2017-07-07


According to the expression profile of retina, PCDH15 is highly expressed in retina. So, it is likely that anti-PCDH15 antibody A03591-1 will work for IHC-F with retina.

Boster Scientific Support

Answered: 2017-07-07


We are currently using anti-PCDH15 antibody A03591-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on monkey tissues as well?

C. Wu

Verified customer

Asked: 2013-03-12


The anti-PCDH15 antibody (A03591-1) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-03-12


how to order through PO

Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.