Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™

Boster Bio Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™ catalog # A01091-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: A01091-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™

See all PI 3-Kinase p110 beta/PIK3CB products

SKU/Catalog Number







Boster Bio Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™ catalog # A01091-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01091-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A01091-1 is reactive to PIK3CB in Human, Mouse, Rat


A01091-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For PIK3CB (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform




PI3/PI4-kinase family

Alternative Names

P110BETA; PI 3Kinase p110 beta; PI 3-Kinase p110 beta; PI3K; PI3KBETA; PIK3C1; PIK3CB phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta; PIK3CB PIK3CB P110BETA, PI3K, PI3KBETA, PIK3C1 phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform|PI3-kinase p110 subunit beta|PI3-kinase subunit beta|PI3K-beta|PtdIns-3-kinase p110|phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta|phosphoinositide-3-kinase, catalytic, beta polypeptide|ptdIns-3-kinase subunit beta|ptdIns-3-kinase subunit p110-beta

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PIK3CB, check out the PIK3CB Infographic

PIK3CB infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PIK3CB: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A01091-1 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

The expression of S100B protein in serum of patients with brain metastases from small-cell lung cancer and its clinical significance

Wang Q, Sun X, Li X, Dong X, Li P, Zhao L. Mol Med Rep. 2015 Jan;11(1):151-8. Doi: 10.3892/Mmr.2014.2762. Epub 2014 Oct 23. Resveratrol Attenuates Intermittent Hypoxia-Induced Insulin Resistance In Rats: Involvement Of Sirtuin 1 And The Phosphatid...

Have you used Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-PI3 Kinase p110 beta/PIK3CB Antibody Picoband™


We are currently using anti-PI3 Kinase p110 beta/PIK3CB antibody A01091-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-16


The anti-PI3 Kinase p110 beta/PIK3CB antibody (A01091-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-16



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.