Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™

Boster Bio Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™ catalog # A02153-2. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A02153-2
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™

See all PTGER4/EP4 products

SKU/Catalog Number

A02153-2

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™ catalog # A02153-2. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02153-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A02153-2 is reactive to PTGER4 in Human

Applications

A02153-2 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For PTGER4 (Source: Uniprot.Org, NCBI)

Uniprot ID

P35408

Gene ID

5734

Gene Name

PTGER4

Full Name

Prostaglandin E2 receptor EP4 subtype

Weight

53.119kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

EP4; EP4R; MGC126583; PGE receptor EP4 subtype; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; Prostanoid EP4 receptor; PTGER2; PTGER4 PTGER4 EP4, EP4R prostaglandin E receptor 4 prostaglandin E2 receptor EP4 subtype|PGE receptor, EP4 subtype|PGE2 receptor EP4 subtype|prostaglandin E receptor 4 (subtype EP4)|prostanoid EP4 receptor

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PTGER4, check out the PTGER4 Infographic

PTGER4 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PTGER4: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A02153-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Prostaglandin E Receptor EP4/PTGER4 Antibody Picoband™

Question

Does anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 work for WB with lung?

Verified Customer

Verified customer

Asked: 2020-04-23

Answer

According to the expression profile of lung, PTGER4 is highly expressed in lung. So, it is likely that anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 will work for WB with lung.

Boster Scientific Support

Answered: 2020-04-23

Question

Is this A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody reactive to the isotypes of PTGER4?

Verified Customer

Verified customer

Asked: 2020-04-06

Answer

The immunogen of A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-06

Question

I was wanting to use your anti-Prostaglandin E Receptor EP4/PTGER4 antibody for WB for human lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human lung identification?

Verified Customer

Verified customer

Asked: 2019-12-17

Answer

It shows on the product datasheet, A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-17

Question

Would anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 work on feline WB with metanephric glomerulus?

Verified Customer

Verified customer

Asked: 2019-10-03

Answer

Our lab technicians have not validated anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline metanephric glomerulus in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-03

Question

We are currently using anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-05-13

Answer

The anti-Prostaglandin E Receptor EP4/PTGER4 antibody (A02153-2) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-05-13

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Prostaglandin E Receptor EP4/PTGER4 antibody A02153-2. Let me know if you need anything else.

N. Huang

Verified customer

Asked: 2016-06-15

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-06-15

Question

Would A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

J. Wu

Verified customer

Asked: 2014-12-22

Answer

It shows on the product datasheet, A02153-2 anti-Prostaglandin E Receptor EP4/PTGER4 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-12-22

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A02153-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.