Anti-Rad51 Antibody Picoband™

Boster Bio Anti-Rad51 Antibody Picoband™ catalog # A00088. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00088
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-Rad51 Antibody Picoband™

See all RAD51 products

SKU/Catalog Number







Boster Bio Anti-Rad51 Antibody Picoband™ catalog # A00088. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Rad51 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00088)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00088 is reactive to RAD51 in Human, Mouse, Rat


A00088 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For RAD51 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

DNA repair protein RAD51 homolog 1




RecA family

Alternative Names

BRCC5; HRAD51; HsRad51; HsT16930; RAD51 (S. cerevisiae) homolog (E coli RecA homolog); RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae); RAD51 homolog A; Rad51; RAD51ABRCA1/BRCA2-containing complex, subunit 5; RAD51L3; RecA, E. coli, homolog of; RECADNA repair protein RAD51 homolog 1; RecA-like protein; recombination protein A RAD51 BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2A, RECA, RAD51 RAD51 recombinase DNA repair protein RAD51 homolog 1|BRCA1/BRCA2-containing complex, subunit 5|RAD51 homolog A|RecA, E. coli, homolog of|RecA-like protein|recombination protein A

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RAD51, check out the RAD51 Infographic

RAD51 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RAD51: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00088

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Rad51 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Rad51 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Rad51 Antibody Picoband™


Can you help my question with product A00088, anti-Rad51 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

S. Li

Verified customer

Asked: 2020-04-22


It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00088 anti-Rad51 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-22


I am interested in to test anti-Rad51 antibody A00088 on human placenta for research purposes, then I may be interested in using anti-Rad51 antibody A00088 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-04-20


The products we sell, including anti-Rad51 antibody A00088, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-04-20


Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-Rad51 antibody A00088. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-01-22


Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-22


Is this A00088 anti-Rad51 antibody reactive to the isotypes of RAD51?

Verified Customer

Verified customer

Asked: 2020-01-08


The immunogen of A00088 anti-Rad51 antibody is A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-08


Our team were satisfied with the WB result of your anti-Rad51 antibody. However we have seen positive staining in brain nucleus using this antibody. Is that expected? Could you tell me where is RAD51 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-10


Based on literature, brain does express RAD51. Generally RAD51 expresses in nucleus. Regarding which tissues have RAD51 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Testis, Pubmed ID: 8479919

Boster Scientific Support

Answered: 2019-12-10


Is a blocking peptide available for product anti-Rad51 antibody (A00088)?

Verified Customer

Verified customer

Asked: 2019-12-02


We do provide the blocking peptide for product anti-Rad51 antibody (A00088). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-02


Will anti-Rad51 antibody A00088 work for WB with placenta?

Verified Customer

Verified customer

Asked: 2019-09-13


According to the expression profile of placenta, RAD51 is highly expressed in placenta. So, it is likely that anti-Rad51 antibody A00088 will work for WB with placenta.

Boster Scientific Support

Answered: 2019-09-13


We are currently using anti-Rad51 antibody A00088 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-06


The anti-Rad51 antibody (A00088) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-06


I was wanting to use your anti-Rad51 antibody for WB for human placenta on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human placenta identification?

Verified Customer

Verified customer

Asked: 2019-06-21


You can see on the product datasheet, A00088 anti-Rad51 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-06-21


Would A00088 anti-Rad51 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

N. Singh

Verified customer

Asked: 2018-07-27


It shows on the product datasheet, A00088 anti-Rad51 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-07-27


I have attached the WB image, lot number and protocol we used for placenta using anti-Rad51 antibody A00088. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-06-29


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-29


Is there a BSA free version of anti-Rad51 antibody A00088 available?

Verified Customer

Verified customer

Asked: 2018-01-18


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Rad51 antibody A00088 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-01-18


I see that the anti-Rad51 antibody A00088 works with WB, what is the protocol used to produce the result images on the product page?

J. Carter

Verified customer

Asked: 2017-11-23


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-11-23


We bought anti-Rad51 antibody for IHC on brain in the past. I am using rat, and We intend to use the antibody for WB next. I would like examining brain as well as embryo in our next experiment. Do you have any suggestion on which antibody would work the best for WB?

C. Wu

Verified customer

Asked: 2017-03-29


I looked at the website and datasheets of our anti-Rad51 antibody and it appears that A00088 has been validated on rat in both IHC and WB. Thus A00088 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website to find out more information about them.

Boster Scientific Support

Answered: 2017-03-29


We have been able to see staining in mouse brain. Any tips? Is anti-Rad51 antibody supposed to stain brain positively?

Z. Rodriguez

Verified customer

Asked: 2014-03-28


From literature brain does express RAD51. From, RAD51 is expressed in embryo, testis, brain, placenta, among other tissues. Regarding which tissues have RAD51 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Testis, Pubmed ID: 8479919

Boster Scientific Support

Answered: 2014-03-28


We want using your anti-Rad51 antibody for chromosome organization involved in meiotic cell cycle studies. Has this antibody been tested with western blotting on 293t whole cell lysate? We would like to see some validation images before ordering.

A. Johnson

Verified customer

Asked: 2014-01-21


We appreciate your inquiry. This A00088 anti-Rad51 antibody is tested on human testis tissue, hela whole cell lysate, a431 whole cell lysate, 293t whole cell lysate, k562 whole cell lysate, jurkat whole cell lysate, a549 whole cell lysate, rat testis tissue, mouse thymus tissue, placenta tissue, brain tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2014-01-21


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.