Anti-Regucalcin/RGN Antibody Picoband™

Boster Bio Anti-Regucalcin/RGN Antibody Picoband™ catalog # A05900-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A05900-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Regucalcin/RGN Antibody Picoband™

See all Regucalcin products

SKU/Catalog Number

A05900-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Regucalcin/RGN Antibody Picoband™ catalog # A05900-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Regucalcin/RGN Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05900-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human Regucalcin (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A05900-1 is reactive to RGN in Human, Mouse, Rat

Applications

A05900-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For RGN (Source: Uniprot.Org, NCBI)

Uniprot ID

Q15493

Gene ID

9104

Gene Name

RGN

Full Name

Regucalcin

Weight

33.253kDa

Superfamily

SMP-30/CGR1 family

Alternative Names

EC 3.1.1.17; gluconolactonase; GNL; RCsenescence marker protein-30; regucalcin (senescence marker protein-30); Senescence marker protein 30; SMP-30; SMP30regucalcin RGN GNL, HEL-S-41, RC, SMP30 regucalcin regucalcin|epididymis secretory protein Li 41|gluconolactonase|senescence marker protein 30

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RGN, check out the RGN Infographic

RGN infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RGN: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A05900-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Regucalcin/RGN Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Regucalcin/RGN Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Regucalcin/RGN Antibody Picoband™

Question

I see that the anti-Regucalcin/RGN antibody A05900-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-11-19

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-19

Question

Would anti-Regucalcin/RGN antibody A05900-1 work on primate WB with liver?

Verified Customer

Verified customer

Asked: 2019-10-08

Answer

Our lab technicians have not validated anti-Regucalcin/RGN antibody A05900-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-Regucalcin/RGN antibody A05900-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate liver in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-08

Question

We are currently using anti-Regucalcin/RGN antibody A05900-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-23

Answer

The anti-Regucalcin/RGN antibody (A05900-1) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-23

Question

We want to test anti-Regucalcin/RGN antibody A05900-1 on human liver for research purposes, then I may be interested in using anti-Regucalcin/RGN antibody A05900-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-01-17

Answer

The products we sell, including anti-Regucalcin/RGN antibody A05900-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-01-17

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A05900-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.