Product Info Summary
| SKU: | PB9158 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IF, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-RUNX2 Antibody Picoband®
SKU/Catalog Number
PB9158
PB0171 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-RUNX2 Antibody Picoband® catalog # PB9158. Tested in IF, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-RUNX2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9158)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RUNX2, identical to the related mouse sequence.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9158 is reactive to RUNX2 in Human
Observed Molecular Weight
56 kDa
Calculated molecular weight
56.6 kDa
Background of RUNX2
Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9158 is guaranteed for IF, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Positive Control
WB: human Hela whole cell, human A431 whole cell, human K562 whole cell, human Jurkat whole cell
ICC/IF: A431 cell
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of RUNX2 using anti-RUNX2 antibody (PB9158).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: recombinant human RUNX2 protein 0.5 ng.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RUNX2 antigen affinity purified polyclonal antibody (Catalog # PB9158) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RUNX2 at approximately 50 kDa. The expected band size for RUNX2 is at 50 kDa.
Click image to see more details
Western blot analysis of RUNX2 using anti-RUNX2 antibody (PB9158).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human A431 whole cell lysates,
Lane 3: human K562 whole cell lysates,
Lane 4: human Jurkat whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RUNX2 antigen affinity purified polyclonal antibody (Catalog # PB9158) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RUNX2 at approximately 56 kDa. The expected band size for RUNX2 is at 57 kDa.
Click image to see more details
IF analysis of RUNX2 using anti-RUNX2 antibody (PB9158).
RUNX2 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-RUNX2 Antibody (PB9158) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Protective effect of isovitexin on AGEs-induced osteoblasts. (A) Effect of isovitexin on the survival rate of osteoblasts (n = 6); (B) ALP activity in osteoblasts (n = 6); (C) Western blotting results of OCN and RUNX2 in osteoblasts (n = 3). ** P < 0.01.
Index in PubMed under a CC BY license. PMID: 39525628
Click image to see more details
Protective effect of MD on AGEs-induced osteoblasts. (A) Effect of MD on the survival rate of osteoblasts (n = 6); (B) ALP activity in osteoblasts (n = 6); (C) Western blotting results of OCN and RUNX2 in osteoblasts (n = 3). * P < 0.05; ** P < 0.01.
Index in PubMed under a CC BY license. PMID: 39525628
Click image to see more details
BMSCs pretreated with EMF exhibited stronger osteogenic differentiation potential. a RUNX2, ALP, OPN, and OCN mRNA levels of two groups analyzed by RT-PCR. GAPDH used as loading control for quantification ( n = 3). b Expression of OPN and RUNX2 proteins of both groups determined by western blot analysis. Relative densitometer values quantified by ImageJ software, GAPDH used as internal control ( n = 3). c Images of Alizarin Red S staining exhibited plaques of calcified extracellular matrix of both groups. Scale bar = 100 μm. d Semi-quantitative analysis of Alizarin Red S staining among both groups ( n = 6). Data shown as mean ± SD. * P < 0.05, ** P < 0.01. EMF electromagnetic field
Index in PubMed under a CC BY license. PMID: 30092831
Specific Publications For Anti-RUNX2 Antibody Picoband® (PB9158)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-RUNX2 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-RUNX2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-RUNX2 Antibody Picoband®
Question
Is there a BSA free version of anti-RUNX2 antibody PB9158 available?
Verified Customer
Verified customer
Asked: 2020-04-28
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-RUNX2 antibody PB9158 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-28
Question
Would PB9158 anti-RUNX2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-12-04
Answer
You can see on the product datasheet, PB9158 anti-RUNX2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-04
Question
We have been able to see staining in human cervix carcinoma. Any tips? Is anti-RUNX2 antibody supposed to stain cervix carcinoma positively?
Verified Customer
Verified customer
Asked: 2019-04-17
Answer
From what I have seen in literature cervix carcinoma does express RUNX2. From what I have seen in Uniprot.org, RUNX2 is expressed in tibia, osteoblast, cervix carcinoma, among other tissues. Regarding which tissues have RUNX2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18220336
Osteoblast, Pubmed ID: 12145306
Boster Scientific Support
Answered: 2019-04-17
Question
Would anti-RUNX2 antibody PB9158 work for WB with osteoblast?
Verified Customer
Verified customer
Asked: 2018-11-23
Answer
According to the expression profile of osteoblast, RUNX2 is highly expressed in osteoblast. So, it is likely that anti-RUNX2 antibody PB9158 will work for WB with osteoblast.
Boster Scientific Support
Answered: 2018-11-23
Question
Please see the WB image, lot number and protocol we used for osteoblast using anti-RUNX2 antibody PB9158. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-10-23
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-10-23
Question
I see that the anti-RUNX2 antibody PB9158 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-10-22
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2018-10-22
Question
I have a question about product PB9158, anti-RUNX2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
H. Jones
Verified customer
Asked: 2018-05-29
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9158 anti-RUNX2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-05-29
Question
Is this PB9158 anti-RUNX2 antibody reactive to the isotypes of RUNX2?
Verified Customer
Verified customer
Asked: 2018-04-30
Answer
The immunogen of PB9158 anti-RUNX2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-04-30
Question
We need to test anti-RUNX2 antibody PB9158 on human osteoblast for research purposes, then I may be interested in using anti-RUNX2 antibody PB9158 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-04-06
Answer
The products we sell, including anti-RUNX2 antibody PB9158, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-04-06
Question
Is a blocking peptide available for product anti-RUNX2 antibody (PB9158)?
Verified Customer
Verified customer
Asked: 2018-03-22
Answer
We do provide the blocking peptide for product anti-RUNX2 antibody (PB9158). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2018-03-22
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for osteoblast using anti-RUNX2 antibody PB9158. Let me know if you need anything else.
K. Lewis
Verified customer
Asked: 2017-10-04
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-10-04
Question
I was wanting to use your anti-RUNX2 antibody for WB for human osteoblast on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human osteoblast identification?
V. Miller
Verified customer
Asked: 2017-10-03
Answer
You can see on the product datasheet, PB9158 anti-RUNX2 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human osteoblast in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-10-03
Question
We are currently using anti-RUNX2 antibody PB9158 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2017-09-20
Answer
The anti-RUNX2 antibody (PB9158) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-09-20
Question
Our lab want to know about using your anti-RUNX2 antibody for runx2 regulates genes involved in cell migration studies. Has this antibody been tested with western blotting on hela whole cell lysate? We would like to see some validation images before ordering.
J. Edwards
Verified customer
Asked: 2016-05-27
Answer
We appreciate your inquiry. This PB9158 anti-RUNX2 antibody is tested on hela whole cell lysate, a431 whole cell lysate, k562 whole cell lysate, jurkat whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2016-05-27
Question
We were well pleased with the WB result of your anti-RUNX2 antibody. However we have seen positive staining in tibia nucleus using this antibody. Is that expected? Could you tell me where is RUNX2 supposed to be expressed?
L. Moore
Verified customer
Asked: 2014-07-29
Answer
From what I have seen in literature, tibia does express RUNX2. Generally RUNX2 expresses in nucleus. Regarding which tissues have RUNX2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18220336
Osteoblast, Pubmed ID: 12145306
Boster Scientific Support
Answered: 2014-07-29


