Show Order Info
Pack Size:100μg/vial
Validated Species:Human
Data & Images


Product Name Anti-RUNX2/Cbfa1 Picoband™ Antibody
SKU/Catalog Number PB9158
Description Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
Cite This Product Anti-RUNX2/Cbfa1 Picoband™ Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9158)
Replacement Item This antibody may replace the following items: sc-12488|sc-10758|sc-8566|sc-101145|sc-390351|sc-390715|sc-12488-X|sc-10758-X|sc-390351-X|sc-8566-X|sc-390715-X from Santa Cruz Biotechnology.
Host Rabbit
Isotype N/A
Validated Species Human
Predicted Species Hamster

*This antibody is predicted to react with the above species based on antigen sequence similarities. Our Boster Guarantee covers the use of this product with the above species.

Application WB

*Our Boster Guarantee covers the use of this product in the above tested applications.

**For positive and negative control design, consult "Tissue specificity" under Protein Target Info.

Recommended Detection Systems Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $50. Contact us for more information
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion for the entire year 2017!
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
Cross Reactivity No cross reactivity with other proteins
Pack Size 100μg/vial


Clonality Polyclonal
Form Lyophilized
Contents Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
*carrier free antibody available upon request.
Concentration Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Purification Immunogen affinity purified.
Isotype N/A

Protein Target Info (Source:

You can check the tissue specificity below for information on selecting positive and negative control.

Gene Name RUNX2
Protein Name Runt-related transcription factor 2
Molecular Weight 56648 MW
Protein Function Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis. Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'- PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation: synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Inhibits KAT6B-dependent transcriptional activation. .
Tissue Specificity Specifically expressed in osteoblasts.
Sequence Similarities Contains 1 Runt domain.
Subcellular Localization Nucleus.
Uniprot ID Q13950
Alternative Names Runt-related transcription factor 2;Acute myeloid leukemia 3 protein;Core-binding factor subunit alpha-1;CBF-alpha-1;Oncogene AML-3;Osteoblast-specific transcription factor 2;OSF-2;Polyomavirus enhancer-binding protein 2 alpha A subunit;PEA2-alpha A;PEBP2-alpha A;SL3-3 enhancer factor 1 alpha A subunit;SL3/AKV core-binding factor alpha A subunit;RUNX2;AML3, CBFA1, OSF2, PEBP2A;
Research Areas |neuroscience|neurology process|neurogenesis| epigenetics and nuclear signaling|transcription|other factors| stem cells|hematopoietic progenitors|intracellular molecules|transcription factors|chromatin binding proteins|dna / rna binding|mesenchymal stem cells|osteogenesis| cancer|oncoproteins/suppressors|oncoproteins|hemangioblast| developmental biology|organogenesis|hematopoietic system development|skeletal development|bone|
*if product is indicated to react with multiple species, protein info is based on the human gene.

Background for Runt-related transcription factor 2

Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.

Anti-RUNX2/Cbfa1 Picoband™ Antibody Images

Click the images to enlarge.

Anti-RUNX2/Cbfa1 Picoband™ Antibody
Anti-RUNX2 Picoband antibody, PB9158-1.jpg
All lanes: Anti RUNX2 (PB9158) at 0.5ug/ml
WB: Recombinant Human RUNX2 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD
Anti-RUNX2/Cbfa1 Picoband™ Antibody
Anti-RUNX2 Picoband antibody, PB9158-2.jpg
All lanes: Anti RUNX2 (PB9158) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A431 Whole Cell Lysate at 40ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 62KD
Write a review for PB9158


Shan T, Zhou C, Yang R, Yan F, Zhang P, Fu Y, Jiang H. Cell Biol Int. 2015 Jan;39(1):35-43. Doi: 10.1002/Cbin.10340. Epub 2014 Jul 28. Lithium Chloride Promotes The Odontoblast Differentiation Of Hair Follicle Neural Crest Cells By Activating Wnt/...
Wang S, Mu J, Fan Z, Yu Y, Yan M, Lei G, Tang C, Wang Z, Zheng Y, Yu J, Zhang G. Stem Cell Res. 2012 May;8(3):346-56. Doi: 10.1016/J.Scr.2011.12.005. Epub 2011 Dec 21. Insulin-Like Growth Factor 1 Can Promote The Osteogenic Differentiation And Ost...
Mu C, Lv T, Wang Z, Ma S, Ma J, Liu J, Yu J, Mu J. Biomed Res Int. 2014;2014:494378. Doi: 10.1155/2014/494378. Epub 2014 Apr 15. Mechanical Stress Stimulates The Osteo/Odontoblastic Differentiation Of Human Stem Cells From Apical Papilla Via Erk 1...
Xue P, Wu X, Zhou L, Ma H, Wang Y, Liu Y, Ma J, Li Y. Biochem Biophys Res Commun. 2013 Apr 5;433(2):226-31. Doi: 10.1016/J.Bbrc.2013.02.088. Epub 2013 Mar 5. Igf1 Promotes Osteogenic Differentiation Of Mesenchymal Stem Cells Derived From Rat Bone ...
Song My, Yu Jz, Zhao Dm, Wei S, Liu Y, Hu Ym, Zhao Wc, Yang Y, Wu H. Cell Biochem Biophys. 2014 May;69(1):47-54. Doi: 10.1007/S12013-013-9764-8. The Time-Dependent Manner Of Sinusoidal Electromagnetic Fields On Rat Bone Marrow Mesenchymal Stem Cel...
Li Jp, Chen S, Peng H, Zhou Jl, Fang Hs. Bioelectromagnetics. 2014 Apr;35(3):170-80. Doi: 10.1002/Bem.21833. Epub 2014 Jan 14. Pulsed Electromagnetic Fields Protect The Balance Between Adipogenesis And Osteogenesis On Steroid-Induced Osteonecrosis...

Customer Q&As

Q: Do you offer BSA-free antibodies? Keyword: Bovine serum albumin, carrier protein, conjugation
A: Yes, please contact us at for more information about BSA-free antibodies and availability. The new BSA-free formula uses trehalose as a replacement to BSA. We have tested many alternative chemicals and found that trehalose protects the antibodies the best.
Q: Can I conjugate markers to this antibody? Can I link custom conjugates to this antibody? Keyword: conjugation
A: The antibody is stored with BSA and cannot be conjugated with markers. Carrier free antibodies are available upon request. Please contact
Q: What should I use for negative control?
A: Please contact us for negative control suggestions. You can also check expression databases such as genecards, uniprot etc. Due to logistic reasons, we do not sell serum or lysates that we use internally for positive or negative control.
Q: Where can I find troubleshooting information? What should I do if I have unexpected bands, high background, no signal, weak signal
A: You can find Boster's troubleshoot guides under tech support tab. Please contact us for further assistance on troubleshooting your experiment.
Q: What is the immunogen sequence of this antibody? Is this antibody polyclonal or monoclonal?
A: You can find the immunogen sequence under "Immunogen" and clonality in the product name.
Q: What is the expected band size? Why is it different than the observed band size?
A: The expected band size is predicted on the size of the protein. The actual band size may be affected by a few other factors including but not limited to:
1. Post-translational modification:phosphorylation, methylation, glycosylation etc. These modifications prevent SDS molecules from binding to the target protein and thus make the band size appear larger than expected
2. Post-translational cleavage: this can cause smaller bands and or multiple bands

3. Alternative splicing: the same gene can have alternative splicing patterns generating different size proteins, all with reactivities to the antibody.

4. Amino Acid R chain charge: SDS binds to positive charges. The different size and charge of the Amino Acid side chains can affect the amount of SDS binding and thus affect the observed band size.
5. Multimers: Multimers are usually broken up in reducing conditions. However if the interactions between the multimers are strong, the band may appear higher.,
Q: What is the suggested dilution ratio for Western Blot (WB), Immunohistochemistry (IHC) and or ELISA standards? What is the optimal pH for the sample?
A: Check the datasheet for the product for details on dilution ratios for different experiments. You can find the datasheet button on the right side of the product page.
Q: What is the protocol you used for your Western blotting (WB) and Immunohistochemistry (IHC)?
A: Check our protocols under the tech support tab.