Anti-SCN11A Antibody Picoband™

SCN11A antibody

Boster Bio Anti-SCN11A Antibody Picoband™ catalog # A04126. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A04126
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-SCN11A Antibody Picoband™

View all SCN11A Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-SCN11A Antibody Picoband™ catalog # A04126. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SCN11A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04126)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A04126 is reactive to SCN11A in Human, Mouse, Rat


A04126 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Background of SCN11A

Sodium channel, voltage-gated, type XI, alpha subunit also known as SCN11A or Nav1.9 is a voltage-gated sodium ion channel protein which is encoded by the SCN11A gene on chromosome 3 in humans. Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family, and is highly expressed in nociceptive neurons of dorsal root ganglia and trigeminal ganglia. It mediates brain-derived neurotrophic factor-evoked membrane depolarization and is a major effector of peripheral inflammatory pain hypersensitivity. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy type VII and familial episodic pain syndrome-3. Alternative splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

"Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For SCN11A (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Sodium channel protein type 11 subunit alpha




sodium channel (TC 1.A.1.10) family

Alternative Names

hNaN; NaN; Nav1.9; Peripheral nerve sodium channel 5; PN5; SCN12A; SNS2; SNS-2; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha; voltage-gated sodium channel Nav1.9; Voltage-gated sodium channel subunit alpha Nav1.9; voltage-gated, type XII, alpha polypeptide SCN11A FEPS3, HSAN7, NAV1.9, NaN, PN5, SCN12A, SNS-2 sodium voltage-gated channel alpha subunit 11 sodium channel protein type 11 subunit alpha|peripheral nerve sodium channel 5|sensory neuron sodium channel 2|sodium channel protein type XI subunit alpha|sodium channel, voltage-gated, type XI, alpha polypeptide|sodium channel, voltage-gated, type XI, alpha subunit|sodium channel, voltage-gated, type XII, alpha polypeptide|voltage-gated sodium channel subunit alpha Nav1.9

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SCN11A, check out the SCN11A Infographic

SCN11A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SCN11A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A04126

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SCN11A Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SCN11A Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-SCN11A Antibody Picoband™


We are currently using anti-SCN11A antibody A04126 for mouse tissue, and we are happy with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-25


The anti-SCN11A antibody (A04126) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-25



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.