Anti-SOX5 Antibody Picoband™

Boster Bio Anti-SOX5 Antibody Picoband™ catalog # PB9507. Tested in WB applications. This antibody reacts with Human, Mouse, Pig, Rat.

Product Info Summary

SKU: PB9507
Size: 100μg/vial
Reactive Species: Human, Mouse, Pig, Rat
Host: Rabbit
Application: WB

Product Name

Anti-SOX5 Antibody Picoband™

See all SOX5 products

SKU/Catalog Number







Boster Bio Anti-SOX5 Antibody Picoband™ catalog # PB9507. Tested in WB applications. This antibody reacts with Human, Mouse, Pig, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SOX5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9507)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9507 is reactive to SOX5 in Human, Mouse, Pig, Rat


PB9507 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Pig

Validation Images & Assay Conditions

Gene/Protein Information For SOX5 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Transcription factor SOX-5



Alternative Names

L-SOX5; MGC35153; SOX5; SRY (sex determining region Y)-box 5; transcription factor SOX-5 SOX5 L-SOX5, L-SOX5B, L-SOX5F, LAMSHF SRY-box transcription factor 5 transcription factor SOX-5|SRY (sex determining region Y)-box 5|SRY-box 5

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SOX5, check out the SOX5 Infographic

SOX5 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SOX5: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9507

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SOX5 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SOX5 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-SOX5 Antibody Picoband™


We are currently using anti-SOX5 antibody PB9507 for pig tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, pig, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-05-07


The anti-SOX5 antibody (PB9507) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-05-07


Is a blocking peptide available for product anti-SOX5 antibody (PB9507)?

Verified Customer

Verified customer

Asked: 2020-04-24


We do provide the blocking peptide for product anti-SOX5 antibody (PB9507). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-04-24


See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-SOX5 antibody PB9507. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-03-05


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-05


Is this PB9507 anti-SOX5 antibody reactive to the isotypes of SOX5?

R. Roberts

Verified customer

Asked: 2014-06-02


The immunogen of PB9507 anti-SOX5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-06-02


I was wanting to use your anti-SOX5 antibody for WB for human cervix carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma identification?

S. Bhatt

Verified customer

Asked: 2013-01-28


As indicated on the product datasheet, PB9507 anti-SOX5 antibody has been validated for WB on human, mouse, pig, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-01-28


Total: $240

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.