Anti-Transcription factor Sp1 SP1 Antibody

Boster Bio Anti-Transcription factor Sp1 SP1 Antibody catalog # RP1072. Tested in WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: RP1072
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-Transcription factor Sp1 SP1 Antibody

See all SP1 products

SKU/Catalog Number

RP1072

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Transcription factor Sp1 SP1 Antibody catalog # RP1072. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Transcription factor Sp1 SP1 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1072)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

RP1072 is reactive to SP1 in Human

Applications

RP1072 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For SP1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P08047

Gene ID

6667

Gene Name

SP1

Full Name

Transcription factor Sp1

Weight

80.693kDa

Superfamily

Sp1 C2H2-type zinc-finger protein family

Alternative Names

Sp1 transcription factor; specificity protein 1; transcription factor Sp1; TSFP1 SP1 Sp1 transcription factor transcription factor Sp1|specificity protein 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SP1, check out the SP1 Infographic

SP1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SP1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

RP1072 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

miR-182 aids in receptive endometrium development in dairy goats by down-regulating PTN expression

Have you used Anti-Transcription factor Sp1 SP1 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Transcription factor Sp1 SP1 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Transcription factor Sp1 SP1 Antibody

Question

Our lab were happy with the WB result of your anti-SP1 antibody. However we have observed positive staining in brain testis nucleus. cytoplasm. note=nuclear location is using this antibody. Is that expected? Could you tell me where is SP1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2018-06-27

Answer

From literature, brain testis does express SP1. Generally SP1 expresses in nucleus. cytoplasm. note=nuclear location is. Regarding which tissues have SP1 expression, here are a few articles citing expression in various tissues:
Brain, and Testis, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 10973950, 16964243, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon, Pubmed ID: 10976766

Boster Scientific Support

Answered: 2018-06-27

Question

you antibody using your anti-SP1 antibody for regulation of cholesterol biosynthetic process studies. Has this antibody been tested with western blotting on hela whole cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-06-06

Answer

Thanks for your inquiry. This RP1072 anti-SP1 antibody is tested on hela whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-06-06

Question

We are currently using anti-SP1 antibody RP1072 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2017-07-19

Answer

The anti-SP1 antibody (RP1072) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-07-19

Question

We have seen staining in human colon. Do you have any suggestions? Is anti-SP1 antibody supposed to stain colon positively?

D. Evans

Verified customer

Asked: 2015-02-09

Answer

From literature colon does express SP1. From Uniprot.org, SP1 is expressed in nipple, brain testis, cervix carcinoma, colon, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have SP1 expression, here are a few articles citing expression in various tissues:
Brain, and Testis, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 10973950, 16964243, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon, Pubmed ID: 10976766

Boster Scientific Support

Answered: 2015-02-09

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
RP1072
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.