Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™

Boster Bio Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™ catalog # PB10101. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: PB10101
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™

See all TGF-beta RI/ALK-5 products

SKU/Catalog Number







Boster Bio Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™ catalog # PB10101. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10101)




Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.




A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB10101 is reactive to TGFBR1 in Human, Mouse, Rat


PB10101 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For TGFBR1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

TGF-beta receptor type-1




protein kinase superfamily

Alternative Names

AAT5; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; Activin receptor-like kinase 5; ACVRLK4; ALK-5; ALK-5ALK5; EC 2.7.11; EC; LDS1A; LDS2A; Serine/threonine-protein kinase receptor R4; SKR4; tbetaR-I; TGFB1R1; TGF-beta receptor type I; TGF-beta receptor type-1; TGF-beta RI; TGF-beta type I receptor; TGFbetaRI; TGFBR1; TGF-bRI; TGFR-1; transforming growth factor beta receptor I; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II-likekinase, 53kD); Transforming growth factor TGFBR1 AAT5, ACVRLK4, ALK-5, ALK5, ESS1, LDS1, LDS1A, LDS2A, MSSE, SKR4, TBR-i, TBRI, TGFR-1, tbetaR-I transforming growth factor beta receptor 1 TGF-beta receptor type-1|activin A receptor type II-like kinase, 53kDa|activin A receptor type II-like protein kinase of 53kD|activin receptor-like kinase 5|mutant transforming growth factor beta receptor I|serine/threonine-protein kinase receptor R4|transforming growth factor beta receptor I|transforming growth factor-beta receptor type I

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TGFBR1, check out the TGFBR1 Infographic

TGFBR1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TGFBR1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB10101 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment

Effects of interferon-alpha on expression of hepatic stellate cell and transforming growth factor-?1 and ?-smooth muscle actin in rats with hepatic fibrosis

Effects of AT1 receptor antagonist, losartan, on rat hepatic fibrosis induced by CCl4

Have you used Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-TGF beta Receptor I/TGFBR1 Antibody Picoband™


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.