Anti-TLS/FUS Antibody Picoband®

FUS antibody

Boster Bio Anti-TLS/FUS Antibody Picoband® catalog # A00771-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A00771-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-TLS/FUS Antibody Picoband®

View all FUS Antibodies

SKU/Catalog Number

A00771-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TLS/FUS Antibody Picoband® catalog # A00771-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TLS/FUS Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00771-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human TLS / FUS, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00771-1 is reactive to FUS in Human, Mouse, Rat

Observed Molecular Weight

75 kDa

Calculated molecular weight

53.4 kDa

Background of FUS

RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma) is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00771-1 is guaranteed for WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/ml

Tested application

TLS antibody was positively detected by WB in:
human HepG2 whole cell, human K562 whole cell, mouse NIH3T3 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-TLS/FUS Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-TLS/FUS Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-TLS/FUS Antibody Picoband®

Question

Do you have a BSA free version of anti-TLS/FUS antibody A00771-1 available?

Verified Customer

Verified customer

Asked: 2020-04-07

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TLS/FUS antibody A00771-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-07

Question

I see that the anti-TLS/FUS antibody A00771-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-24

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2020-02-24

Question

We were well pleased with the WB result of your anti-TLS/FUS antibody. However we have observed positive staining in erythroleukemia nucleus using this antibody. Is that expected? Could you tell me where is FUS supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-31

Answer

Based on literature, erythroleukemia does express FUS. Generally FUS expresses in nucleus. Regarding which tissues have FUS expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 24129315
Erythroleukemia, Pubmed ID: 23186163
Fetal brain cortex, Pubmed ID: 8187069, 9660765
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Lung, and Lymph, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-12-31

Question

I have attached the WB image, lot number and protocol we used for lung lymph using anti-TLS/FUS antibody A00771-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-09

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-09

Question

I have a question about product A00771-1, anti-TLS/FUS antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-11-21

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00771-1 anti-TLS/FUS antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-11-21

Question

Will anti-TLS/FUS antibody A00771-1 work for WB with lung lymph?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

According to the expression profile of lung lymph, FUS is highly expressed in lung lymph. So, it is likely that anti-TLS/FUS antibody A00771-1 will work for WB with lung lymph.

Boster Scientific Support

Answered: 2019-09-02

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung lymph using anti-TLS/FUS antibody A00771-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-05-20

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-20

Question

We have observed staining in mouse fetal brain cortex. Any tips? Is anti-TLS/FUS antibody supposed to stain fetal brain cortex positively?

Verified Customer

Verified customer

Asked: 2019-02-27

Answer

From what I have seen in literature fetal brain cortex does express FUS. From what I have seen in Uniprot.org, FUS is expressed in right testis, lung lymph, fetal brain cortex, leukemic t-cell, erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have FUS expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 24129315
Erythroleukemia, Pubmed ID: 23186163
Fetal brain cortex, Pubmed ID: 8187069, 9660765
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Lung, and Lymph, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-02-27

Question

We are currently using anti-TLS/FUS antibody A00771-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?

F. Mitchell

Verified customer

Asked: 2018-08-21

Answer

The anti-TLS/FUS antibody (A00771-1) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-08-21

Question

I am interested in to test anti-TLS/FUS antibody A00771-1 on rat lung lymph for research purposes, then I may be interested in using anti-TLS/FUS antibody A00771-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-06-20

Answer

The products we sell, including anti-TLS/FUS antibody A00771-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-06-20

Question

Is a blocking peptide available for product anti-TLS/FUS antibody (A00771-1)?

Verified Customer

Verified customer

Asked: 2017-07-05

Answer

We do provide the blocking peptide for product anti-TLS/FUS antibody (A00771-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2017-07-05

Question

Would A00771-1 anti-TLS/FUS antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-06-28

Answer

As indicated on the product datasheet, A00771-1 anti-TLS/FUS antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-06-28

Question

Is this A00771-1 anti-TLS/FUS antibody reactive to the isotypes of FUS?

F. Mitchell

Verified customer

Asked: 2016-12-16

Answer

The immunogen of A00771-1 anti-TLS/FUS antibody is A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-12-16

Question

I was wanting to use your anti-TLS/FUS antibody for WB for rat lung lymph on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat lung lymph identification?

R. Krishna

Verified customer

Asked: 2013-09-02

Answer

As indicated on the product datasheet, A00771-1 anti-TLS/FUS antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat lung lymph in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-09-02

Order DetailsPrice
A00771-1

100μg

$370
A00771-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A00771-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A00771-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A00771-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A00771-1-APC

100 μg APC conjugated (liquid)

$820
A00771-1-FITC

100 μg FITC conjugated (liquid)

$570
A00771-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A00771-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A00771-1-HRP

100 μg HRP conjugated (liquid)

$570
A00771-1-PE

100 μg PE conjugated (liquid)

$820
A00771-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00771-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 24, 2026