Anti-TLS/FUS Antibody Picoband™

Boster Bio Anti-TLS/FUS Antibody Picoband™ catalog # A00771-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00771-1
Size: 100ug/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-TLS/FUS Antibody Picoband™

See all FUS products

SKU/Catalog Number

A00771-1

Size

100ug/vial

Form

Lyophilized

Description

Boster Bio Anti-TLS/FUS Antibody Picoband™ catalog # A00771-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TLS/FUS Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00771-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00771-1 is reactive to FUS in Human, Mouse, Rat

Applications

A00771-1 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For FUS (Source: Uniprot.Org, NCBI)

Uniprot ID

P35637

Gene ID

2521

Gene Name

FUS

Full Name

RNA-binding protein FUS

Weight

53.426kDa

Superfamily

RRM TET family

Alternative Names

75 kDa DNA-pairing protein; ALS6; amyotrophic lateral sclerosis 6; FUS1; fused in sarcoma; fusion (involved in t(12;16) in malignant liposarcoma); fusion gene in myxoid liposarcoma; fusion, derived from t(12;16) malignant liposarcoma; fus-like protein; heterogeneous nuclear ribonucleoprotein P2; HNRNPP2; Oncogene FUS; Oncogene TLS; POMP75; RNA-binding protein FUS; TLShnRNP-P2; Translocated in liposarcoma protein FUS ALS6, ETM41, HNRNPP2, POMP75, TLS, altFUS, FUS FUS RNA binding protein RNA-binding protein FUS|75 kDa DNA-pairing protein|fus-like protein|fused in sarcoma|fusion gene in myxoid liposarcoma|heterogeneous nuclear ribonucleoprotein P2|oncogene FUS|oncogene TLS|translocated in liposarcoma protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on FUS, check out the FUS Infographic

FUS infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for FUS: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00771-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TLS/FUS Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TLS/FUS Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-TLS/FUS Antibody Picoband™

Question

Do you have a BSA free version of anti-TLS/FUS antibody A00771-1 available?

Verified Customer

Verified customer

Asked: 2020-04-07

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TLS/FUS antibody A00771-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-07

Question

I see that the anti-TLS/FUS antibody A00771-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-24

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-02-24

Question

We were well pleased with the WB result of your anti-TLS/FUS antibody. However we have observed positive staining in erythroleukemia nucleus using this antibody. Is that expected? Could you tell me where is FUS supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-31

Answer

Based on literature, erythroleukemia does express FUS. Generally FUS expresses in nucleus. Regarding which tissues have FUS expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 24129315
Erythroleukemia, Pubmed ID: 23186163
Fetal brain cortex, Pubmed ID: 8187069, 9660765
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Lung, and Lymph, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-12-31

Question

I have attached the WB image, lot number and protocol we used for lung lymph using anti-TLS/FUS antibody A00771-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-12-09

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-09

Question

I have a question about product A00771-1, anti-TLS/FUS antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-11-21

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00771-1 anti-TLS/FUS antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-11-21

Question

Will anti-TLS/FUS antibody A00771-1 work for WB with lung lymph?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

According to the expression profile of lung lymph, FUS is highly expressed in lung lymph. So, it is likely that anti-TLS/FUS antibody A00771-1 will work for WB with lung lymph.

Boster Scientific Support

Answered: 2019-09-02

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung lymph using anti-TLS/FUS antibody A00771-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-05-20

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-20

Question

We have observed staining in mouse fetal brain cortex. Any tips? Is anti-TLS/FUS antibody supposed to stain fetal brain cortex positively?

Verified Customer

Verified customer

Asked: 2019-02-27

Answer

From what I have seen in literature fetal brain cortex does express FUS. From what I have seen in Uniprot.org, FUS is expressed in right testis, lung lymph, fetal brain cortex, leukemic t-cell, erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have FUS expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 24129315
Erythroleukemia, Pubmed ID: 23186163
Fetal brain cortex, Pubmed ID: 8187069, 9660765
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Lung, and Lymph, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-02-27

Question

We are currently using anti-TLS/FUS antibody A00771-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?

F. Mitchell

Verified customer

Asked: 2018-08-21

Answer

The anti-TLS/FUS antibody (A00771-1) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-08-21

Question

I am interested in to test anti-TLS/FUS antibody A00771-1 on rat lung lymph for research purposes, then I may be interested in using anti-TLS/FUS antibody A00771-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-06-20

Answer

The products we sell, including anti-TLS/FUS antibody A00771-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-06-20

Question

Is a blocking peptide available for product anti-TLS/FUS antibody (A00771-1)?

Verified Customer

Verified customer

Asked: 2017-07-05

Answer

We do provide the blocking peptide for product anti-TLS/FUS antibody (A00771-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-07-05

Question

Would A00771-1 anti-TLS/FUS antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-06-28

Answer

As indicated on the product datasheet, A00771-1 anti-TLS/FUS antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-06-28

Question

Is this A00771-1 anti-TLS/FUS antibody reactive to the isotypes of FUS?

F. Mitchell

Verified customer

Asked: 2016-12-16

Answer

The immunogen of A00771-1 anti-TLS/FUS antibody is A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-12-16

Question

I was wanting to use your anti-TLS/FUS antibody for WB for rat lung lymph on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat lung lymph identification?

R. Krishna

Verified customer

Asked: 2013-09-02

Answer

As indicated on the product datasheet, A00771-1 anti-TLS/FUS antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat lung lymph in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-09-02

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00771-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.