Anti-TMEM107 Antibody Picoband™

Boster Bio Anti-TMEM107 Antibody Picoband™ catalog # A04966. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A04966
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC-P, WB

Product Name

Anti-TMEM107 Antibody Picoband™

See all TMEM107 products

SKU/Catalog Number







Boster Bio Anti-TMEM107 Antibody Picoband™ catalog # A04966. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TMEM107 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04966)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A04966 is reactive to TMEM107 in Human


A04966 is guaranteed for Flow Cytometry, IHC-P, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For TMEM107 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Transmembrane protein 107



Alternative Names

transmembrane protein 107 TMEM107 GRVS638, JBTS29, MKS13, PRO1268 transmembrane protein 107 transmembrane protein 107

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TMEM107, check out the TMEM107 Infographic

TMEM107 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TMEM107: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A04966

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TMEM107 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TMEM107 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-TMEM107 Antibody Picoband™


Is this A04966 anti-TMEM107 antibody reactive to the isotypes of TMEM107?

Verified Customer

Verified customer

Asked: 2020-01-06


The immunogen of A04966 anti-TMEM107 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-06


We are currently using anti-TMEM107 antibody A04966 for human tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-27


The anti-TMEM107 antibody (A04966) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-27


Here is the WB image, lot number and protocol we used for right uterine tube using anti-TMEM107 antibody A04966. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-27


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-27


I see that the anti-TMEM107 antibody A04966 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-03-15


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-03-15


Will anti-TMEM107 antibody A04966 work for WB with right uterine tube?

Verified Customer

Verified customer

Asked: 2019-02-21


According to the expression profile of right uterine tube, TMEM107 is highly expressed in right uterine tube. So, it is likely that anti-TMEM107 antibody A04966 will work for WB with right uterine tube.

Boster Scientific Support

Answered: 2019-02-21


Would A04966 anti-TMEM107 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-12-24


It shows on the product datasheet, A04966 anti-TMEM107 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-12-24


I have a question about product A04966, anti-TMEM107 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-11-14


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04966 anti-TMEM107 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-14


Is a blocking peptide available for product anti-TMEM107 antibody (A04966)?

Verified Customer

Verified customer

Asked: 2018-08-23


We do provide the blocking peptide for product anti-TMEM107 antibody (A04966). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-08-23


My question regards to test anti-TMEM107 antibody A04966 on human right uterine tube for research purposes, then I may be interested in using anti-TMEM107 antibody A04966 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

P. Krishna

Verified customer

Asked: 2018-07-12


The products we sell, including anti-TMEM107 antibody A04966, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-07-12


Is there a BSA free version of anti-TMEM107 antibody A04966 available?

J. Taylor

Verified customer

Asked: 2018-07-12


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TMEM107 antibody A04966 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-07-12


I was wanting to use your anti-TMEM107 antibody for WB for human right uterine tube on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human right uterine tube identification?

Verified Customer

Verified customer

Asked: 2017-09-19


It shows on the product datasheet, A04966 anti-TMEM107 antibody has been tested for Flow Cytometry, IHC-P, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human right uterine tube in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-19


Will anti-TMEM107 antibody A04966 work on pig Flow Cytometry with right uterine tube?

N. Huang

Verified customer

Asked: 2016-11-30


Our lab technicians have not tested anti-TMEM107 antibody A04966 on pig. You can run a BLAST between pig and the immunogen sequence of anti-TMEM107 antibody A04966 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig right uterine tube in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-11-30


We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for right uterine tube using anti-TMEM107 antibody A04966. Let me know if you need anything else.

K. Carter

Verified customer

Asked: 2014-07-25


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-07-25



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.