Overview
Product Name |
Anti-TMEM107 Antibody Picoband™
See more TMEM107 products |
Catalog# |
A04966 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-TMEM107 Antibody Picoband™ catalog # A04966. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-TMEM107 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04966)
|
Antibodies Validation |
Antibodies Validation Information
|
Product Specs
Host |
Rabbit |
Reactive Species |
Human |
Applications |
Flow Cytometry, IHC-P, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids. |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For TMEM107 (Source: Uniprot.org, NCBI)
Uniprot Id | Q6UX40 |
---|
NCBI Gene Id | 84314 |
---|
Species Of This Entry | Human |
---|
Gene Name | TMEM107 |
---|
Protein Name | Transmembrane protein 107 |
---|
Alternative Names | TMEM107|transmembrane protein 107 |
---|
Molecular Weight | 15503 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on TMEM107, check out the TMEM107 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for TMEM107: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the TMEM107 infographic
Our Boster Quality Guarantee for Anti-TMEM107 Antibody Picoband™ covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Flow Cytometry, 1-3μg/1x10
6 cells, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.
Figure 2. IHC analysis of TMEM107 using anti-TMEM107 antibody (A04966).
TMEM107 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-TMEM107 Antibody (A04966) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Figure 3. IHC analysis of TMEM107 using anti-TMEM107 antibody (A04966).
TMEM107 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-TMEM107 Antibody (A04966) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.

Figure 1. Western blot analysis of TMEM107 using anti-TMEM107 antibody (A04966).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: MCF-7 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM107 antigen affinity purified polyclonal antibody (Catalog # A04966) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TMEM107 at approximately 22KD. The expected band size for TMEM107 is at 16KD.
Figure 5. Flow Cytometry analysis of SiHa cells using anti-TMEM107 antibody (A04966).
Overlay histogram showing SiHa cells stained with A04966 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-TMEM107 Antibody (A04966,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A04966 Anti-TMEM107 Antibody Picoband™
13 Related Questions
Question
Is this A04966 anti-TMEM107 antibody reactive to the isotypes of TMEM107?
Verified Customer
Asked: 2020-01-06
Answer
The immunogen of A04966 anti-TMEM107 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-06
Question
We are currently using anti-TMEM107 antibody A04966 for human tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on primate tissues as well?
Verified Customer
Asked: 2019-06-27
Answer
The anti-TMEM107 antibody (A04966) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-27
Question
Here is the WB image, lot number and protocol we used for right uterine tube using anti-TMEM107 antibody A04966. Please let me know if you require anything else.
Verified Customer
Asked: 2019-06-27
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-27
Question
I see that the anti-TMEM107 antibody A04966 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Asked: 2019-03-15
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-03-15
Question
Will anti-TMEM107 antibody A04966 work for WB with right uterine tube?
Verified Customer
Asked: 2019-02-21
Answer
According to the expression profile of right uterine tube, TMEM107 is highly expressed in right uterine tube. So, it is likely that anti-TMEM107 antibody A04966 will work for WB with right uterine tube.
Boster Scientific Support
Answered: 2019-02-21
Question
Would A04966 anti-TMEM107 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Asked: 2018-12-24
Answer
It shows on the product datasheet, A04966 anti-TMEM107 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-12-24
Question
I have a question about product A04966, anti-TMEM107 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Asked: 2018-11-14
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04966 anti-TMEM107 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-11-14
Question
Is a blocking peptide available for product anti-TMEM107 antibody (A04966)?
Verified Customer
Asked: 2018-08-23
Answer
We do provide the blocking peptide for product anti-TMEM107 antibody (A04966). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-08-23
Question
My question regards to test anti-TMEM107 antibody A04966 on human right uterine tube for research purposes, then I may be interested in using anti-TMEM107 antibody A04966 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
P. Krishna
Asked: 2018-07-12
Answer
The products we sell, including anti-TMEM107 antibody A04966, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-07-12
Question
Is there a BSA free version of anti-TMEM107 antibody A04966 available?
J. Taylor
Asked: 2018-07-12
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TMEM107 antibody A04966 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-07-12
Question
I was wanting to use your anti-TMEM107 antibody for WB for human right uterine tube on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human right uterine tube identification?
Verified Customer
Asked: 2017-09-19
Answer
It shows on the product datasheet, A04966 anti-TMEM107 antibody has been tested for Flow Cytometry, IHC-P, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human right uterine tube in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-09-19
Question
Will anti-TMEM107 antibody A04966 work on pig Flow Cytometry with right uterine tube?
N. Huang
Asked: 2016-11-30
Answer
Our lab technicians have not tested anti-TMEM107 antibody A04966 on pig. You can run a BLAST between pig and the immunogen sequence of anti-TMEM107 antibody A04966 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig right uterine tube in Flow Cytometry, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-11-30
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for right uterine tube using anti-TMEM107 antibody A04966. Let me know if you need anything else.
K. Carter
Asked: 2014-07-25
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2014-07-25