Anti-ULK1 Antibody Picoband™

Boster Bio Anti-ULK1 Antibody Picoband™ catalog # A00584-1. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00584-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC-P, WB

Product Name

Anti-ULK1 Antibody Picoband™

See all ULK1 products

SKU/Catalog Number







Boster Bio Anti-ULK1 Antibody Picoband™ catalog # A00584-1. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ULK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00584-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human ULK1 (EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00584-1 is reactive to ULK1 in Human, Mouse, Rat


A00584-1 is guaranteed for Flow Cytometry, IHC-P, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ULK1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Serine/threonine-protein kinase ULK1




protein kinase superfamily

Alternative Names

ATG1 autophagy related 1 homolog; ATG1; ATG1A; EC 2.7.11; EC; FLJ38455; FLJ46475; KIAA0722; serine/threonine-protein kinase ULK1; unc-51 (C. elegans)-like kinase 1; UNC51; Unc51.1; unc-51-like kinase 1 (C. elegans); Unc-51-like kinase 1 ULK1 ATG1, ATG1A, UNC51, Unc51.1, hATG1 unc-51 like autophagy activating kinase 1 serine/threonine-protein kinase ULK1|ATG1 autophagy related 1 homolog|autophagy-related protein 1 homolog

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ULK1, check out the ULK1 Infographic

ULK1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ULK1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00584-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ULK1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ULK1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-ULK1 Antibody Picoband™


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.