Anti-nmt55/p54nrb/NONO Antibody Picoband®

NONO antibody

Boster Bio Anti-nmt55/p54nrb/NONO Antibody Picoband® catalog # PB9875. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: PB9875
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-nmt55/p54nrb/NONO Antibody Picoband®

View all NONO Antibodies

SKU/Catalog Number

PB9875
PB0922 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-nmt55/p54nrb/NONO Antibody Picoband® catalog # PB9875. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-nmt55/p54nrb/NONO Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9875)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9875 is reactive to NONO in Human, Mouse, Rat

Observed Molecular Weight

60 kDa

Calculated molecular weight

54.2 kDa

Background of NONO

Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. 

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9875 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat
Immunocytochemistry/Immunofluorescence2μg/mlHuman
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

nmt55 antibody was positively detected by WB in:
human Hela whole cell, human A549 whole cell, human SW620 whole cell, human PANC-1 whole cell, human U20S whole cell, rat lung tissue, mouse lung tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
nmt55 antibody was positively detected by IHC in:
mouse brain tissue, human lung cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue, rat intestine tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
nmt55 antibody was positively detected by IF in:
U20S cell, SKOV-3 cell
nmt55 antibody was positively detected by IF in:
human colon cancer tissue
nmt55 antibody was positively detected by FC in:
HELA cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-nmt55/p54nrb/NONO Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-nmt55/p54nrb/NONO Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-nmt55/p54nrb/NONO Antibody Picoband®

Question

We are currently using anti-nmt55/p54nrb/NONO antibody PB9875 for mouse tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-04

Answer

The anti-nmt55/p54nrb/NONO antibody (PB9875) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-04

Question

Does anti-nmt55/p54nrb/NONO antibody PB9875 work for WB with cervix carcinoma erythroleukemia?

Verified Customer

Verified customer

Asked: 2019-12-23

Answer

According to the expression profile of cervix carcinoma erythroleukemia, NONO is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-nmt55/p54nrb/NONO antibody PB9875 will work for WB with cervix carcinoma erythroleukemia.

Boster Scientific Support

Answered: 2019-12-23

Question

Is this PB9875 anti-nmt55/p54nrb/NONO antibody reactive to the isotypes of NONO?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

The immunogen of PB9875 anti-nmt55/p54nrb/NONO antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-28

Question

I was wanting to use your anti-nmt55/p54nrb/NONO antibody for WB for human cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma erythroleukemia identification?

L. Dhar

Verified customer

Asked: 2016-06-07

Answer

You can see on the product datasheet, PB9875 anti-nmt55/p54nrb/NONO antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-06-07

Question

Is a blocking peptide available for product anti-nmt55/p54nrb/NONO antibody (PB9875)?

J. Jha

Verified customer

Asked: 2015-08-19

Answer

We do provide the blocking peptide for product anti-nmt55/p54nrb/NONO antibody (PB9875). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2015-08-19

Question

Can you help my question with product PB9875, anti-nmt55/p54nrb/NONO antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

S. Wu

Verified customer

Asked: 2015-04-21

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9875 anti-nmt55/p54nrb/NONO antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-04-21

Order DetailsPrice
PB9875

100μg

$370
PB9875-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9875-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9875-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9875-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9875-APC

100 μg APC conjugated (liquid)

$820
PB9875-FITC

100 μg FITC conjugated (liquid)

$570
PB9875-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9875-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9875-HRP

100 μg HRP conjugated (liquid)

$570
PB9875-PE

100 μg PE conjugated (liquid)

$820
PB9875-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9875
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 20, 2026