Overview
Product Name |
Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ (monoclonal, 6G5)
See more YWHAZ products |
Catalog# |
M01141 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ (monoclonal, 6G5) catalog # M01141. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ (monoclonal, 6G5) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M01141)
|
Antibodies Validation |
Antibodies Validation Information
|
Product Specs
Host |
Mouse |
Reactive Species |
Human, Monkey, Mouse, Rat |
Applications |
Flow Cytometry, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ). |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For YWHAZ (Source: Uniprot.org, NCBI)
Uniprot Id | P63104 |
---|
NCBI Gene Id | 7534 |
---|
Species Of This Entry | Human |
---|
Gene Name | YWHAZ |
---|
Protein Name | 14-3-3 protein zeta/delta |
---|
Superfamily | 14-3-3 family |
---|
Alternative Names | YWHAZ|1433 zeta; 14-3-3 zeta; KCIP-1; KCIP-1MGC126532,14-3-3-zeta; MGC111427; MGC138156; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide; YWHAZ; zeta polypeptide |
---|
Molecular Weight | 27745 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on YWHAZ, check out the YWHAZ Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for YWHAZ: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the YWHAZ infographic
Our Boster Quality Guarantee for Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ (monoclonal, 6G5) covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Monkey, Rat
Flow Cytometry, 1-3μg/1x10
6 cells, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody (M01141).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates;
Lane 2: human A549 whole cell lysates;
Lane 3: monkey COS-7 whole cell lysates;
Lane 4: human Raji whole cell lysates;
Lane 5:huamn Caco-2 whole cell lysates;
Lane 6: huamn Jurkat whole cell lysates;
Lane 7: mouse brain tissue lysates;
Lane 8: rat brain tissue lysates
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-14-3-3 zeta/delta antigen affinity purified monoclonal antibody (Catalog # M01141) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1001) with Tanon 5200 system. A specific band was detected for 14-3-3 zeta/delta at approximately 28KD. The expected band size for 14-3-3 zeta/delta is at 28KD.
Figure 2. Flow Cytometry analysis of PC-3 cells using anti-14-3-3 zeta/delta antibody (M01141).
Overlay histogram showing PC-3 cells stained with M01141 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-14-3-3 zeta/delta Antibody (M01141,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Figure 3. Flow Cytometry analysis of SiHa cells using anti-14-3-3 zeta/delta antibody (M01141).
Overlay histogram showing SiHa cells stained with M01141 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-14-3-3 zeta/delta Antibody (M01141,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to M01141 Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ (monoclonal, 6G5)
0 Related Questions