Anti-AFF4 Antibody Picoband®

AFF4 antibody

Boster Bio Anti-AFF4 Antibody Picoband® catalog # A03824. Tested in Flow Cytometry, IP, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A03824
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IP, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-AFF4 Antibody Picoband®

View all AFF4 Antibodies

SKU/Catalog Number

A03824

Size

100 μg/vial

Form

Lyophilized

Description

AFF4 is commonly described as a scaffold component of the super elongation complex involved in transcriptional elongation control (putative here due to page access failure), with disease-context usage in some leukemia/transcription-dysregulation studies (putative). Assay context: per provided product description, validated for Flow Cytometry, IP, IHC, and Western blot in Human; for IP/IHC workflows, analytical confirmation can be framed within broader assay services method-context. Often interpreted alongside DNA-damage checkpoint signaling such as TP53BP1 (53BP1) (putative transcription–damage response adjacency) and nucleocytoplasmic transport factors such as AGFG1 (putative).

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AFF4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03824)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4, identical to the related mouse sequence.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A03824 is reactive to AFF4 in Human, Mouse, Rat

Observed Molecular Weight

150 kDa

Calculated molecular weight

127.5 kDa

Background of AFF4

The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A03824 is guaranteed for Flow Cytometry, IP, IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)2-5μg/mlHuman, Mouse, Rat
Immunoprecipitation0.5-2 μg/mlHuman
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

AFF4 antibody was positively detected by WB in:
human Hela whole cell, human HepG2 whole cell, human 293T whole cell, human U87 whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, mouse Neuro-2a whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
AFF4 antibody was positively detected by IHC in:
human placenta tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
AFF4 antibody was positively detected by IP in:
293T cell
AFF4 antibody was positively detected by FC in:
SiHa cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-AFF4 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-AFF4 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-AFF4 Antibody Picoband®

Question

Will anti-AFF4 antibody A03824 work for Flow Cytometry with leukemic t-cell?

Verified Customer

Verified customer

Asked: 2020-02-18

Answer

According to the expression profile of leukemic t-cell, AFF4 is highly expressed in leukemic t-cell. So, it is likely that anti-AFF4 antibody A03824 will work for Flow Cytometry with leukemic t-cell.

Boster Scientific Support

Answered: 2020-02-18

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-AFF4 antibody A03824. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-10-02

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-02

Question

Is this A03824 anti-AFF4 antibody reactive to the isotypes of AFF4?

Verified Customer

Verified customer

Asked: 2019-06-19

Answer

The immunogen of A03824 anti-AFF4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-19

Question

We are currently using anti-AFF4 antibody A03824 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?

S. Wu

Verified customer

Asked: 2017-08-16

Answer

The anti-AFF4 antibody (A03824) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-08-16

Question

Will anti-AFF4 antibody A03824 work on pig IHC-F with brain?

Verified Customer

Verified customer

Asked: 2017-07-20

Answer

Our lab technicians have not tested anti-AFF4 antibody A03824 on pig. You can run a BLAST between pig and the immunogen sequence of anti-AFF4 antibody A03824 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig brain in IHC-F, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-07-20

Order DetailsPrice
A03824

100μg

$370
A03824-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A03824-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A03824-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A03824-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A03824-APC

100 μg APC conjugated (liquid)

$820
A03824-FITC

100 μg FITC conjugated (liquid)

$570
A03824-Cy3

100 μg Cy3 conjugated (liquid)

$570
A03824-Biotin

100 μg Biotin conjugated (liquid)

$570
A03824-HRP

100 μg HRP conjugated (liquid)

$570
A03824-PE

100 μg PE conjugated (liquid)

$820
A03824-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A03824
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 22, 2026