Anti-AFF4 Antibody Picoband™

AFF4 antibody

Boster Bio Anti-AFF4 Antibody Picoband™ catalog # A03824. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A03824
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-AFF4 Antibody Picoband™

View all AFF4 Antibodies

SKU/Catalog Number

A03824

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AFF4 Antibody Picoband™ catalog # A03824. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AFF4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03824)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4, identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A03824 is reactive to AFF4 in Human

Applications

A03824 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Observed Molecular Weight

150 kDa

Calculated molecular weight

127.459kDa

Background of AFF4

The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For AFF4 (Source: Uniprot.org, NCBI)

Gene Name

AFF4

Full Name

AF4/FMR2 family member 4

Weight

127.459kDa

Superfamily

AF4 family

Alternative Names

AF4/FMR2 family, member 4; AF5Q31AF4/FMR2 family member 4; ALL1-fused gene from chromosome 5q31 protein; Major CDK9 elongation factor-associated protein; MCEFALL1 fused gene from 5q31; MGC75036; Protein AF-5q31 AFF4 AF5Q31, CHOPS, MCEF AF4/FMR2 family member 4 AF4/FMR2 family member 4|ALL1-fused gene from chromosome 5q31 protein|major CDK9 elongation factor-associated protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AFF4, check out the AFF4 Infographic

AFF4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AFF4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A03824

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-AFF4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-AFF4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-AFF4 Antibody Picoband™

Question

Will anti-AFF4 antibody A03824 work for Flow Cytometry with leukemic t-cell?

Verified Customer

Verified customer

Asked: 2020-02-18

Answer

According to the expression profile of leukemic t-cell, AFF4 is highly expressed in leukemic t-cell. So, it is likely that anti-AFF4 antibody A03824 will work for Flow Cytometry with leukemic t-cell.

Boster Scientific Support

Answered: 2020-02-18

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-AFF4 antibody A03824. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-10-02

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-02

Question

Is this A03824 anti-AFF4 antibody reactive to the isotypes of AFF4?

Verified Customer

Verified customer

Asked: 2019-06-19

Answer

The immunogen of A03824 anti-AFF4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-19

Question

We are currently using anti-AFF4 antibody A03824 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?

S. Wu

Verified customer

Asked: 2017-08-16

Answer

The anti-AFF4 antibody (A03824) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-08-16

Question

Will anti-AFF4 antibody A03824 work on pig IHC-F with brain?

Verified Customer

Verified customer

Asked: 2017-07-20

Answer

Our lab technicians have not tested anti-AFF4 antibody A03824 on pig. You can run a BLAST between pig and the immunogen sequence of anti-AFF4 antibody A03824 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig brain in IHC-F, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-07-20

Size

Conjugation

Total: $370

SKU:A03824

In stock, 3+ left.

Order within 32 hours and 53 minutes to receive by Thu Mar 21

Get A Quote
Eddy test
In stock
Order Product
A03824
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.