Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12)

Boster Bio Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12) catalog # M03824. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: M03824
Size: 100μg/vial
Reactive Species: Human
Host: Mouse
Application: Flow Cytometry, WB

Product Name

Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12)

See all AFF4 products

SKU/Catalog Number

M03824

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12) catalog # M03824. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M03824)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Monoclonal

Clone Number

8G12

Isotype

IgG2b

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.

Reactive Species

M03824 is reactive to AFF4 in Human

Applications

M03824 is guaranteed for Flow Cytometry, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For AFF4 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q9UHB7

Gene ID

27125

Gene Name

AFF4

Full Name

AF4/FMR2 family member 4

Weight

127.459kDa

Superfamily

AF4 family

Alternative Names

AF4/FMR2 family, member 4; AF5Q31AF4/FMR2 family member 4; ALL1-fused gene from chromosome 5q31 protein; Major CDK9 elongation factor-associated protein; MCEFALL1 fused gene from 5q31; MGC75036; Protein AF-5q31 AFF4 AF5Q31, CHOPS, MCEF AF4/FMR2 family member 4 AF4/FMR2 family member 4|ALL1-fused gene from chromosome 5q31 protein|major CDK9 elongation factor-associated protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on AFF4, check out the AFF4 Infographic

AFF4 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for AFF4: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M03824

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-AFF4 Picoband™ Antibody (monoclonal, 8G12)

$280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
M03824
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.