Product Info Summary
SKU: | PB9366 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-AIF/AIFM1 Antibody Picoband™
SKU/Catalog Number
PB9366
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-AIF/AIFM1 Antibody Picoband™ catalog # PB9366. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-AIF/AIFM1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9366)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AIF, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9366 is reactive to AIFM1 in Human, Mouse, Rat
Applications
PB9366 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
67 kDa
Calculated molecular weight
66.901kDa
Background of AIF
Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunocytochemistry, 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of AIF using anti-AIF antibody (PB9366).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates,
Lane 2: human A549 whole cell lysates,
Lane 3: human PC-3 whole cell lysates,
Lane 4: human K562 whole cell lysates,
Lane 5: human Caco-2 whole cell lysates,
Lane 6: human Hela whole cell lysates,
Lane 7: human HL-60 whole cell lysates,
Lane 8: human U-87MG whole cell lysates,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody (Catalog # PB9366) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
Click image to see more details
Figure 2. IHC analysis of AIF using anti-AIF antibody (PB9366).
AIF was detected in paraffin-embedded section of Mouse Cardiac Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-AIF Antibody (PB9366) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of AIF using anti-AIF antibody (PB9366).
AIF was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-AIF Antibody (PB9366) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of AIF using anti-AIF antibody (PB9366).
AIF was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-AIF Antibody (PB9366) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of AIF using anti-AIF antibody (PB9366).
AIF was detected in immunocytochemical section of SMMC-7721 Cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 1μg/ml rabbit anti-AIF Antibody (PB9366) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. Western blot analysis of AIF using anti-AIF antibody (PB9366).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat spleen tissue lysates,
Lane 2: rat ovary tissue lysates,
Lane 3: rat lung tissue lysates,
Lane 4: rat liver tissue lysates,
Lane 5: mouse spleen tissue lysates,
Lane 6: mouse testis tissue lysates,
Lane 7: mouse lung tissue lysates,
Lane 8: mouse liver tissue lysates,
Lane 9: mouse ovary tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AIF antigen affinity purified polyclonal antibody (Catalog # PB9366) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for AIF at approximately 67KD. The expected band size for AIF is at 67KD.
Click image to see more details
Figure 7. IF analysis of AIF using anti-AIF antibody (PB9366).
AIF was detected in immunocytochemical section of NIH3T3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-AIF Antibody (PB9366) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 8. IF analysis of AIF using anti-AIF antibody (PB9366).
AIF was detected in immunocytochemical section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-AIF Antibody (PB9366) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 9. Flow Cytometry analysis of Hela cells using anti-AIF antibody (PB9366).
Overlay histogram showing Hela cells stained with PB9366 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-AIF Antibody (PB9366,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For AIFM1 (Source: Uniprot.org, NCBI)
Gene Name
AIFM1
Full Name
Apoptosis-inducing factor 1, mitochondrial
Weight
66.901kDa
Superfamily
FAD-dependent oxidoreductase family
Alternative Names
AIF; AIFapoptosis-inducing factor 1, mitochondrial; AIFM1; apoptosis-inducing factor, mitochondrion-associated, 1; COXPD6; MGC111425; PDCD8; PDCD8striatal apoptosis-inducing factor; programmed cell death 8 (apoptosis-inducing factor); Programmed cell death protein 8 AIFM1 AIF, AUNX1, CMT2D, CMTX4, COWCK, COXPD6, DFNX5, NADMR, NAMSD, PDCD8, SEMDHL apoptosis inducing factor mitochondria associated 1 apoptosis-inducing factor 1, mitochondrial|apoptosis-inducing factor, mitochondrion-associated, 1|auditory neuropathy, X-linked recessive 1|programmed cell death 8 (apoptosis-inducing factor)|striatal apoptosis-inducing factor|testicular secretory protein Li 4
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AIFM1, check out the AIFM1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AIFM1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-AIF/AIFM1 Antibody Picoband™ (PB9366)
Hello CJ!
PB9366 has been cited in 4 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Protection by bicyclol derivatives against acetaminophen‐induced acute liver failure in mice and its active mechanism
Icariin induces apoptosis in acute promyelocytic leukemia by targeting PIM1
Wnt5a Increases Properties of Lung Cancer Stem Cells and Resistance to Cisplatin through Activation of Wnt5a/PKC Signaling Pathway
Mechanism of apoptosis induction in human hepatocellular carcinoma cells following treatment with a gecko peptides mixture
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-AIF/AIFM1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-AIF/AIFM1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-AIF/AIFM1 Antibody Picoband™
Question
Is this PB9366 anti-AIF/AIFM1 antibody reactive to the isotypes of AIFM1?
Verified Customer
Verified customer
Asked: 2020-04-20
Answer
The immunogen of PB9366 anti-AIF/AIFM1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-20
Question
Here is the WB image, lot number and protocol we used for cervix carcinoma using anti-AIF/AIFM1 antibody PB9366. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-04-10
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-10
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma using anti-AIF/AIFM1 antibody PB9366. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-04-02
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-02
Question
We ordered your anti-AIF/AIFM1 antibody for WB on cervix carcinoma erythroleukemia in a previous project. I am using human, and We are going to use the antibody for IHC-P next. Our lab want to know about examining cervix carcinoma erythroleukemia as well as apex of heart in our next experiment. Do you have any suggestion on which antibody would work the best for IHC-P?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
I took a look at the website and datasheets of our anti-AIF/AIFM1 antibody and it seems that PB9366 has been validated on human in both WB and IHC-P. Thus PB9366 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC-P in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC-P detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-03-24
Question
I was wanting to use your anti-AIF/AIFM1 antibody for IHC-P for mouse cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma identification?
Verified Customer
Verified customer
Asked: 2020-01-16
Answer
As indicated on the product datasheet, PB9366 anti-AIF/AIFM1 antibody has been validated for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-01-16
Question
We have been able to see staining in rat kidney. Any tips? Is anti-AIF/AIFM1 antibody supposed to stain kidney positively?
Verified Customer
Verified customer
Asked: 2019-11-27
Answer
From what I have seen in literature kidney does express AIFM1. From what I have seen in Uniprot.org, AIFM1 is expressed in apex of heart, kidney, brain, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have AIFM1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 10913597, 15489334
Cervix carcinoma, Pubmed ID: 18669648, 18691976
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2019-11-27
Question
Our lab want to know about using your anti-AIF/AIFM1 antibody for mitochondrial respiratory chain complex i assembly studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-10-25
Answer
Thank you for your inquiry. This PB9366 anti-AIF/AIFM1 antibody is validated on human placenta tissue, a549 whole cell lysates, k562 whole cell lysates, hela whole cell lysates, mouse ovary tissue, cardiac muscle tissue, rat ovary tissue, intestinal cancer tissue, spleen tissue, lung tissue, liver tissue, testis tissue. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-10-25
Question
Can you help my question with product PB9366, anti-AIF/AIFM1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
C. Moore
Verified customer
Asked: 2019-10-04
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9366 anti-AIF/AIFM1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-04
Question
Will PB9366 anti-AIF/AIFM1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-06-11
Answer
It shows on the product datasheet, PB9366 anti-AIF/AIFM1 antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-06-11
Question
Will anti-AIF/AIFM1 antibody PB9366 work for IHC-P with cervix carcinoma?
J. Rodriguez
Verified customer
Asked: 2019-04-22
Answer
According to the expression profile of cervix carcinoma, AIFM1 is highly expressed in cervix carcinoma. So, it is likely that anti-AIF/AIFM1 antibody PB9366 will work for IHC-P with cervix carcinoma.
Boster Scientific Support
Answered: 2019-04-22
Question
I see that the anti-AIF/AIFM1 antibody PB9366 works with IHC-P, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-09-28
Answer
You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-09-28
Question
you antibody to test anti-AIF/AIFM1 antibody PB9366 on mouse cervix carcinoma for research purposes, then I may be interested in using anti-AIF/AIFM1 antibody PB9366 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
B. Gonzalez
Verified customer
Asked: 2015-08-21
Answer
The products we sell, including anti-AIF/AIFM1 antibody PB9366, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-08-21
Question
Our lab were well pleased with the WB result of your anti-AIF/AIFM1 antibody. However we have been able to see positive staining in liver isoform 5: cytoplasm using this antibody. Is that expected? Could you tell me where is AIFM1 supposed to be expressed?
R. Mangal
Verified customer
Asked: 2014-07-09
Answer
From literature, liver does express AIFM1. Generally AIFM1 expresses in mitochondrion intermembrane space., isoform 3: mitochondrion intermembrane space, isoform 5: cytoplasm. Regarding which tissues have AIFM1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 10913597, 15489334
Cervix carcinoma, Pubmed ID: 18669648, 18691976
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 14702039
Liver, Pubmed ID: 24275569
Boster Scientific Support
Answered: 2014-07-09
Question
We are currently using anti-AIF/AIFM1 antibody PB9366 for mouse tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?
C. Krishna
Verified customer
Asked: 2014-04-01
Answer
The anti-AIF/AIFM1 antibody (PB9366) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-04-01
Question
Is there a BSA free version of anti-AIF/AIFM1 antibody PB9366 available?
D. Anderson
Verified customer
Asked: 2014-02-06
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AIF/AIFM1 antibody PB9366 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-02-06
Question
Is a blocking peptide available for product anti-AIF/AIFM1 antibody (PB9366)?
S. Huang
Verified customer
Asked: 2013-04-10
Answer
We do provide the blocking peptide for product anti-AIF/AIFM1 antibody (PB9366). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-04-10