Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7)

Boster Bio Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7) catalog # M00546-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: M00546-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7)

See all ALDH2 products

SKU/Catalog Number

M00546-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7) catalog # M00546-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00546-1)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Monoclonal

Clone Number

5G7

Isotype

IgG2a

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M00546-1 is reactive to ALDH2 in Human, Mouse, Rat

Applications

M00546-1 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ALDH2 (Source: Uniprot.Org, NCBI)

Uniprot ID

P05091

Gene ID

217

Gene Name

ALDH2

Full Name

Aldehyde dehydrogenase, mitochondrial

Weight

56.381kDa

Superfamily

aldehyde dehydrogenase family

Alternative Names

acetaldehyde dehydrogenase 2; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH2; ALDH-E2; ALDHI; ALDM; EC 1.2.1; EC 1.2.1.3; liver mitochondrial ALDH; MGC1806; nucleus-encoded mitochondrial aldehyde dehydrogenase 2 ALDH2 ALDH-E2, ALDHI, ALDM aldehyde dehydrogenase 2 family member aldehyde dehydrogenase, mitochondrial|ALDH class 2|acetaldehyde dehydrogenase 2|aldehyde dehydrogenase 2 family (mitochondrial)|epididymis secretory sperm binding protein|liver mitochondrial ALDH|nucleus-encoded mitochondrial aldehyde dehydrogenase 2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ALDH2, check out the ALDH2 Infographic

ALDH2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ALDH2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

M00546-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Li Y,Chen F,Chen J,Chan S,He Y,Liu W,Zhang G.Disulfiram/Copper Induces Antitumor Activity against Both Nasopharyngeal Cancer Cells and Cancer-Associated Fibroblasts through ROS/MAPK and Ferroptosis Pathways.Cancers (Basel).2020 Jan 6;12(1):138.doi:10.3390
Species: Human,Mouse
M00546-1 usage in article: APP:WB, SAMPLE:NPC CELL LINES AND NP69 CELL, DILUTION:1:100

Have you used Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-ALDH2 Antibody Picoband™ (monoclonal, 5G7)

$240

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
M00546-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.