Product Info Summary
| SKU: | A12967 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband®
SKU/Catalog Number
A12967
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband® catalog # A12967. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A12967)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1, different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A12967 is reactive to AMY1A in Human, Mouse, Rat
Observed Molecular Weight
58 kDa
Calculated molecular weight
57.8 kDa
Background of AMY1A
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A12967 is guaranteed for IHC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Immunohistochemistry (Paraffin-embedded Section) | 0.5-1μg/ml | Human |
| Western blot | 0.1-0.5μg/ml | Mouse, Rat, Human |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Validation Images & Assay Conditions
Click image to see more details
IHC analysis of Amylase using anti-Amylase antibody (A12967).
Amylase was detected in paraffin-embedded section of human pancreatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Amylase Antibody (A12967) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Western blot analysis of Amylase using anti-Amylase antibody (A12967).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat pancreas tissue lysates,
Lane 2: mouse pancreas tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Amylase antigen affinity purified polyclonal antibody (Catalog # A12967) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Amylase at approximately 58KD. The expected band size for Amylase is at 58KD.
Specific Publications For Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband® (A12967)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband®
Question
See below the WB image, lot number and protocol we used for thyroid using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967. Please let me know if you require anything else.
H. Jones
Verified customer
Asked: 2019-03-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-03-29
Question
Would anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 work on horse WB with thyroid?
L. Walker
Verified customer
Asked: 2018-12-10
Answer
Our lab technicians have not validated anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on horse. You can run a BLAST between horse and the immunogen sequence of anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse thyroid in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-12-10
Question
We are interested in to test anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on human thyroid for research purposes, then I may be interested in using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-02-06
Answer
The products we sell, including anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-02-06
Question
Is this A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody reactive to the isotypes of AMY1A?
S. Collins
Verified customer
Asked: 2017-07-19
Answer
The immunogen of A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-07-19


