Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™

Boster Bio Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™ catalog # A12967. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A12967
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™

See all Salivary Amylase Alpha products

SKU/Catalog Number

A12967

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™ catalog # A12967. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A12967)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A12967 is reactive to AMY1A in Human, Mouse, Rat

Applications

A12967 is guaranteed for IHC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For AMY1A (Source: Uniprot.Org, NCBI)

Uniprot ID

P04745

Gene ID

276

Gene Name

AMY1A

Full Name

Alpha-amylase 1

Weight

57.768kDa

Superfamily

glycosyl hydrolase 13 family

Alternative Names

1,4-alpha-D-glucan glucanohydrolase 1; alpha-amylase 1; AMY1; AMY1B; AMY1C; amylase, alpha 1A (salivary); amylase, alpha 1A; salivary; amylase, salivary, alpha-1A; EC 3.2.1.1; glycogenase; Salivary alpha-amylase; salivary amylase alpha 1A AMY1A AMY1 amylase alpha 1A alpha-amylase 1A|1,4-alpha-D-glucan glucanohydrolase 1|alpha-amylase 1|amylase alpha 1A (salivary)|amylase, salivary, alpha-1A|glycogenase|salivary alpha-amylase|salivary amylase alpha 1A

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on AMY1A, check out the AMY1A Infographic

AMY1A infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for AMY1A: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A12967

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C Antibody Picoband™

Question

See below the WB image, lot number and protocol we used for thyroid using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967. Please let me know if you require anything else.

H. Jones

Verified customer

Asked: 2019-03-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-03-29

Question

Would anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 work on horse WB with thyroid?

L. Walker

Verified customer

Asked: 2018-12-10

Answer

Our lab technicians have not validated anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on horse. You can run a BLAST between horse and the immunogen sequence of anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse thyroid in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-12-10

Question

We are interested in to test anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on human thyroid for research purposes, then I may be interested in using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-02-06

Answer

The products we sell, including anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-02-06

Question

Is this A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody reactive to the isotypes of AMY1A?

S. Collins

Verified customer

Asked: 2017-07-19

Answer

The immunogen of A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-07-19

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A12967
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.