Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™

Salivary Amylase Alpha antibody

Boster Bio Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™ catalog # A12967. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: A12967
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™

View all Salivary Amylase Alpha Antibodies

SKU/Catalog Number

A12967

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™ catalog # A12967. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A12967)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1, different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A12967 is reactive to AMY1A in Human, Mouse, Rat

Applications

A12967 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

58 kDa

Calculated molecular weight

57.768kDa

Background of Salivary Amylase Alpha

Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For AMY1A (Source: Uniprot.org, NCBI)

Gene Name

AMY1A

Full Name

Alpha-amylase 1

Weight

57.768kDa

Superfamily

glycosyl hydrolase 13 family

Alternative Names

1,4-alpha-D-glucan glucanohydrolase 1; alpha-amylase 1; AMY1; AMY1B; AMY1C; amylase, alpha 1A (salivary); amylase, alpha 1A; salivary; amylase, salivary, alpha-1A; EC 3.2.1.1; glycogenase; Salivary alpha-amylase; salivary amylase alpha 1A AMY1A AMY1 amylase alpha 1A alpha-amylase 1A|1,4-alpha-D-glucan glucanohydrolase 1|alpha-amylase 1|amylase alpha 1A (salivary)|amylase, salivary, alpha-1A|glycogenase|salivary alpha-amylase|salivary amylase alpha 1A

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AMY1A, check out the AMY1A Infographic

AMY1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AMY1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A12967 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Isolation and characterization of a novel oncogene, amplified in liver cancer 1, within a commonly amplified region at 1q21 in hepatocellular carcinoma
Species: Human

Have you used Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Amylase/AMY1A/AMY1B/AMY1C Antibody Picoband™

Question

See below the WB image, lot number and protocol we used for thyroid using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967. Please let me know if you require anything else.

H. Jones

Verified customer

Asked: 2019-03-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-03-29

Question

Would anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 work on horse WB with thyroid?

L. Walker

Verified customer

Asked: 2018-12-10

Answer

Our lab technicians have not validated anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on horse. You can run a BLAST between horse and the immunogen sequence of anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse thyroid in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-12-10

Question

We are interested in to test anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 on human thyroid for research purposes, then I may be interested in using anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-02-06

Answer

The products we sell, including anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody A12967, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-02-06

Question

Is this A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody reactive to the isotypes of AMY1A?

S. Collins

Verified customer

Asked: 2017-07-19

Answer

The immunogen of A12967 anti-Alpha Amylase 1/AMY1A/AMY1B/AMY1C antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-07-19

Order DetailsPrice
A12967

100μg

$370
A12967-10ug

10μg sample (liquid)

$99
A12967-Biotin

100 μg Biotin conjugated

$570
A12967-Cy3

100 μg Cy3 conjugated

$570
A12967-Dylight488

100 μg Dylight488 conjugated

$570
A12967-Dylight550

100 μg Dylight550 conjugated

$570
A12967-Dylight594

100 μg Dylight594 conjugated

$570
A12967-FITC

100 μg FITC conjugated

$570
A12967-HRP

100 μg HRP conjugated

$570
A12967-APC

100 μg APC conjugated

$670
A12967-PE

100 μg PE conjugated

$670
A12967-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A12967
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.