Anti-AP2M1 Antibody Picoband™

AP2M1 antibody

Boster Bio Anti-AP2M1 Antibody Picoband™ catalog # A06179. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A06179
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-AP2M1 Antibody Picoband™

View all AP2M1 Antibodies

SKU/Catalog Number

A06179

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-AP2M1 Antibody Picoband™ catalog # A06179. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-AP2M1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A06179)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A06179 is reactive to AP2M1 in Human, Mouse, Rat

Applications

A06179 is guaranteed for WB Boster Guarantee

Background of AP2M1

AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For AP2M1 (Source: Uniprot.org, NCBI)

Uniprot ID

Q96CW1

Gene ID

1173

Gene Name

AP2M1

Full Name

AP-2 complex subunit mu

Weight

49.655kDa

Superfamily

adaptor complexes medium subunit family

Alternative Names

Adaptin-mu2; adaptor-related protein complex 2, mu 1 subunit; AP-2 mu chain; Clathrin assembly protein complex 2 medium chain; clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; clathrin-associated/assembly/adaptor protein, medium 1; HA2 50 kDa subunit; KIAA0109; mu subunit; Plasma membrane adaptor AP-2 50 kDa protein; plasma membrane adaptor AP-2 50kDA protein AP2M1 AP50, CLAPM1, MRD60, mu2 adaptor related protein complex 2 subunit mu 1 AP-2 complex subunit mu|AP-2 mu 2 chain|HA2 50 kDA subunit|adaptin-mu2|adaptor protein complex AP-2 subunit mu|adaptor related protein complex 2 mu 1 subunit|adaptor-related protein complex 2 subunit mu|clathrin adaptor complex AP2, mu subunit|clathrin assembly protein complex 2 medium chain|clathrin assembly protein complex 2 mu medium chain|clathrin coat adaptor protein AP50|clathrin coat assembly protein AP50|clathrin coat-associated protein AP50|clathrin-associated/assembly/adaptor protein, medium 1|plasma membrane adaptor AP-2 50 kDa protein|plasma membrane adaptor AP-2 50kDA protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AP2M1, check out the AP2M1 Infographic

AP2M1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AP2M1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A06179

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-AP2M1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-AP2M1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-AP2M1 Antibody Picoband™

Question

We are currently using anti-AP2M1 antibody A06179 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on canine tissues as well?

A. Li

Verified customer

Asked: 2018-04-17

Answer

The anti-AP2M1 antibody (A06179) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-04-17

Size

Conjugation

Total: $315

SKU:A06179

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A06179
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.