Product Info Summary
| SKU: | PB9979 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Argonaute 4/AGO4 Antibody Picoband®
SKU/Catalog Number
PB9979
PB1041 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Argonaute 4/AGO4 Antibody Picoband® catalog # PB9979. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Argonaute 4/AGO4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9979)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4, identical to the related mouse sequence.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9979 is reactive to AGO4 in Human, Mouse, Rat
Observed Molecular Weight
100 kDa
Calculated molecular weight
97.1 kDa
Background of AGO4
AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9979 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human
Positive Control
WB: human Hela whole cell, human 293T whole cell, human Jurkat whole cell
IHC: human endometrial cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of AGO4 using anti-AGO4 antibody (PB9979).
Electrophoresis was performed on a 10% SDS-PAGE gel at 80V (Stacking gel) / 120V (Resolving gel) for 2 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human 293T whole cell lysates,
Lane 3: human Jurkat whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AGO4 antigen affinity purified polyclonal antibody (PB9979) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody (Catalog # BA1054) at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an ECL Plus Western Blotting Substrate (Catalog # AR1196-200) with Tanon 5200 system. A specific band was detected for AGO4 at approximately 100 kDa. The expected band size for AGO4 is at 97 kDa.
Click image to see more details
IHC analysis of AGO4 using anti-AGO4 antibody (PB9979).
AGO4 was detected in a paraffin-embedded section of human endometrial cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-AGO4 Antibody (PB9979) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Specific Publications For Anti-Argonaute 4/AGO4 Antibody Picoband® (PB9979)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Argonaute 4/AGO4 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Argonaute 4/AGO4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-Argonaute 4/AGO4 Antibody Picoband®
Question
Is this PB9979 anti-Argonaute 4/AGO4 antibody reactive to the isotypes of AGO4?
Verified Customer
Verified customer
Asked: 2020-02-10
Answer
The immunogen of PB9979 anti-Argonaute 4/AGO4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-10
Question
We are currently using anti-Argonaute 4/AGO4 antibody PB9979 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-20
Answer
The anti-Argonaute 4/AGO4 antibody (PB9979) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-20
Question
Would anti-Argonaute 4/AGO4 antibody PB9979 work for WB with frontal cortex?
Verified Customer
Verified customer
Asked: 2019-06-10
Answer
According to the expression profile of frontal cortex, AGO4 is highly expressed in frontal cortex. So, it is likely that anti-Argonaute 4/AGO4 antibody PB9979 will work for WB with frontal cortex.
Boster Scientific Support
Answered: 2019-06-10
Question
Would anti-Argonaute 4/AGO4 antibody PB9979 work on feline WB with brain?
Verified Customer
Verified customer
Asked: 2019-04-30
Answer
Our lab technicians have not tested anti-Argonaute 4/AGO4 antibody PB9979 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Argonaute 4/AGO4 antibody PB9979 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-04-30
Question
I see that the anti-Argonaute 4/AGO4 antibody PB9979 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-10-18
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2018-10-18


