Product Info Summary
SKU: | PB9979 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Argonaute 4/AGO4 Antibody Picoband™
SKU/Catalog Number
PB9979
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Argonaute 4/AGO4 Antibody Picoband™ catalog # PB9979. Tested in WB applications. This antibody reacts with Human, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Argonaute 4/AGO4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9979)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9979 is reactive to Ago4 in Human, Rat
Applications
PB9979 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
115 kDa
Calculated molecular weight
97.037kDa
Background of Ago4
AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Argonaute 4 using anti-Argonaute 4 antibody (PB9979).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat thymus tissue lysates,
Lane 2: 22RV1 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Argonaute 4 antigen affinity purified polyclonal antibody (Catalog # PB9979) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Argonaute 4 at approximately 115 kDa. The expected band size for Argonaute 4 is at 97 kDa.
Protein Target Info & Infographic
Gene/Protein Information For Ago4 (Source: Uniprot.org, NCBI)
Gene Name
Ago4
Full Name
Protein argonaute-4
Weight
97.037kDa
Superfamily
argonaute family
Alternative Names
Protein argonaute-4 Ago4|5730550L01Rik, AI481660, Eif2c, Eif2c4|argonaute RISC catalytic subunit 4|protein argonaute-4|Piwi/Argonaute family protein meIF2C4|argonaute 4|argonaute RISC catalytic component 4|eukaryotic translation initiation factor 2C, 4
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Ago4, check out the Ago4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Ago4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Argonaute 4/AGO4 Antibody Picoband™ (PB9979)
Hello CJ!
No publications found for PB9979
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Argonaute 4/AGO4 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-Argonaute 4/AGO4 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-Argonaute 4/AGO4 Antibody Picoband™
Question
Is this PB9979 anti-Argonaute 4/AGO4 antibody reactive to the isotypes of AGO4?
Verified Customer
Verified customer
Asked: 2020-02-10
Answer
The immunogen of PB9979 anti-Argonaute 4/AGO4 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-10
Question
We are currently using anti-Argonaute 4/AGO4 antibody PB9979 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-20
Answer
The anti-Argonaute 4/AGO4 antibody (PB9979) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-20
Question
Would anti-Argonaute 4/AGO4 antibody PB9979 work for WB with frontal cortex?
Verified Customer
Verified customer
Asked: 2019-06-10
Answer
According to the expression profile of frontal cortex, AGO4 is highly expressed in frontal cortex. So, it is likely that anti-Argonaute 4/AGO4 antibody PB9979 will work for WB with frontal cortex.
Boster Scientific Support
Answered: 2019-06-10
Question
Would anti-Argonaute 4/AGO4 antibody PB9979 work on feline WB with brain?
Verified Customer
Verified customer
Asked: 2019-04-30
Answer
Our lab technicians have not tested anti-Argonaute 4/AGO4 antibody PB9979 on feline. You can run a BLAST between feline and the immunogen sequence of anti-Argonaute 4/AGO4 antibody PB9979 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-04-30
Question
I see that the anti-Argonaute 4/AGO4 antibody PB9979 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-10-18
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-10-18