Anti-BDKRB2 Antibody Picoband™

Boster Bio Anti-BDKRB2 Antibody Picoband™ catalog # PB10047. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PB10047
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-BDKRB2 Antibody Picoband™

See all Bradykinin RB2/BDKRB2 products

SKU/Catalog Number







Boster Bio Anti-BDKRB2 Antibody Picoband™ catalog # PB10047. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-BDKRB2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10047)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB10047 is reactive to BDKRB2 in Human


PB10047 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For BDKRB2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

B2 bradykinin receptor




G-protein coupled receptor 1 family

Alternative Names

B2 bradykinin receptor; B2R; BDKRB2; BK-2 receptor; BK2; BK-2; BKR2; Bradykinin RB2; bradykinin receptor B2; BradykininRB2; BRB2; DKFZp686O088 BDKRB2 B2R, BK-2, BK2, BKR2, BRB2 bradykinin receptor B2 B2 bradykinin receptor|BK-2 receptor

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on BDKRB2, check out the BDKRB2 Infographic

BDKRB2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for BDKRB2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB10047

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-BDKRB2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-BDKRB2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-BDKRB2 Antibody Picoband™


you antibody to test anti-BDKRB2 antibody PB10047 on human lung for research purposes, then I may be interested in using anti-BDKRB2 antibody PB10047 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-24


The products we sell, including anti-BDKRB2 antibody PB10047, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-24


We are currently using anti-BDKRB2 antibody PB10047 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?

C. Taylor

Verified customer

Asked: 2017-08-16


The anti-BDKRB2 antibody (PB10047) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-08-16


My question regarding product PB10047, anti-BDKRB2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

K. Jones

Verified customer

Asked: 2015-09-16


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10047 anti-BDKRB2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-09-16


Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.